Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7077.t1
Gene name
Locationscaffold_21:3799..5106
Strand+
Gene length (bp)1307
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03060 NMO Nitronate monooxygenase 5.9E-55 9 339
PF00478 IMPDH IMP dehydrogenase / GMP reductase domain 2.8E-12 6 236
PF01070 FMN_dh FMN-dependent dehydrogenase 1.1E-07 141 244

GO

GO Term Description Terminal node
GO:0018580 nitronate monooxygenase activity Yes
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity Yes
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:0016703 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of one atom of oxygen (internal monooxygenases or internal mixed function oxidases) No
GO:0004497 monooxygenase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7077.t1
MASPQQIRTPITDLLKINHPILLAGMNVAAGPKLAAAVTNAGGLGVIGGVGYSPEMLREQIAELKSYLNDKNAPF
GVDLLLPQVGGSARKTNYDYTKGKLGELVDIIIQEKASLFVSAVGVPPKAVVDKLHSAGILCMNMIGHPKHVQKA
LDVGIDIICAQGGEGGGHTGDVPTTILIPTVAKLVEGKKSPLTGQPVQVIAAGGLFNGNSVAAALMLGASAVWIG
TRFILADEAGAPAAHQEAVRTSNFEDNIRTIIFTGRPLRVRKNPYIVNWEENRHDEIKELTSKGIIPVEHDMENL
PDDVDDETLDNARPWLMGKVAAVVNEKKPAKAIVDELVSDAAVLLQKGNKMVAKL*
Coding >Pro_DTO377G3_2|g7077.t1
ATGGCTTCTCCTCAACAAATCCGTACCCCGATCACTGATCTGCTCAAGATCAACCACCCCATCCTGCTGGCAGGC
ATGAACGTGGCTGCGGGGCCCAAGCTGGCCGCCGCTGTCACCAACGCCGGTGGTCTGGGTGTGATCGGCGGTGTT
GGCTACTCCCCCGAGATGCTACGCGAACAAATCGCCGAACTCAAGAGCTACCTTAACGACAAGAACGCTCCCTTC
GGTGTCGACCTCCTCCTTCCCCAGGTTGGCGGTAGTGCCCGCAAGACCAACTACGACTACACCAAGGGCAAGCTC
GGTGAGCTCGTTGATATTATTATCCAGGAGAAGGCTAGCCTTTTCGTCTCCGCCGTCGGCGTCCCCCCCAAGGCT
GTTGTCGACAAGCTCCACAGTGCCGGCATCCTCTGCATGAACATGATCGGCCACCCCAAGCACGTCCAGAAGGCC
CTGGATGTTGGTATTGATATTATCTGCGCACAGGGTGGTGAGGGCGGTGGTCACACCGGTGATGTCCCTACCACC
ATCCTCATCCCCACCGTTGCCAAGTTGGTCGAGGGCAAGAAGAGCCCTCTGACCGGCCAGCCCGTGCAAGTCATC
GCGGCCGGTGGTCTGTTCAACGGTAACTCGGTTGCTGCTGCTCTGATGCTGGGTGCCTCCGCTGTCTGGATCGGT
ACCCGCTTCATCCTGGCTGATGAGGCTGGCGCCCCCGCCGCTCACCAGGAGGCCGTCCGCACTTCCAACTTCGAG
GACAACATCCGTACCATTATCTTCACTGGACGTCCCCTCCGTGTTCGCAAGAACCCTTACATCGTCAACTGGGAG
GAGAACCGTCACGATGAGATCAAGGAGCTCACCTCCAAGGGTATCATCCCTGTCGAGCACGATATGGAGAACTTG
CCCGATGATGTCGATGACGAGACTTTGGACAATGCCCGTCCTTGGCTGATGGGCAAGGTTGCCGCCGTTGTCAAC
GAGAAGAAGCCTGCCAAGGCTATCGTTGACGAGCTCGTCAGCGATGCCGCTGTCCTGCTCCAGAAGGGCAACAAG
ATGGTTGCTAAGCTGTAA
Transcript >Pro_DTO377G3_2|g7077.t1
ATGGCTTCTCCTCAACAAATCCGTACCCCGATCACTGATCTGCTCAAGATCAACCACCCCATCCTGCTGGCAGGC
ATGAACGTGGCTGCGGGGCCCAAGCTGGCCGCCGCTGTCACCAACGCCGGTGGTCTGGGTGTGATCGGCGGTGTT
GGCTACTCCCCCGAGATGCTACGCGAACAAATCGCCGAACTCAAGAGCTACCTTAACGACAAGAACGCTCCCTTC
GGTGTCGACCTCCTCCTTCCCCAGGTTGGCGGTAGTGCCCGCAAGACCAACTACGACTACACCAAGGGCAAGCTC
GGTGAGCTCGTTGATATTATTATCCAGGAGAAGGCTAGCCTTTTCGTCTCCGCCGTCGGCGTCCCCCCCAAGGCT
GTTGTCGACAAGCTCCACAGTGCCGGCATCCTCTGCATGAACATGATCGGCCACCCCAAGCACGTCCAGAAGGCC
CTGGATGTTGGTATTGATATTATCTGCGCACAGGGTGGTGAGGGCGGTGGTCACACCGGTGATGTCCCTACCACC
ATCCTCATCCCCACCGTTGCCAAGTTGGTCGAGGGCAAGAAGAGCCCTCTGACCGGCCAGCCCGTGCAAGTCATC
GCGGCCGGTGGTCTGTTCAACGGTAACTCGGTTGCTGCTGCTCTGATGCTGGGTGCCTCCGCTGTCTGGATCGGT
ACCCGCTTCATCCTGGCTGATGAGGCTGGCGCCCCCGCCGCTCACCAGGAGGCCGTCCGCACTTCCAACTTCGAG
GACAACATCCGTACCATTATCTTCACTGGACGTCCCCTCCGTGTTCGCAAGAACCCTTACATCGTCAACTGGGAG
GAGAACCGTCACGATGAGATCAAGGAGCTCACCTCCAAGGGTATCATCCCTGTCGAGCACGATATGGAGAACTTG
CCCGATGATGTCGATGACGAGACTTTGGACAATGCCCGTCCTTGGCTGATGGGCAAGGTTGCCGCCGTTGTCAAC
GAGAAGAAGCCTGCCAAGGCTATCGTTGACGAGCTCGTCAGCGATGCCGCTGTCCTGCTCCAGAAGGGCAACAAG
ATGGTTGCTAAGCTGTAA
Gene >Pro_DTO377G3_2|g7077.t1
ATGGCTTCTCCTCGTAAGTGTTCTATATCCCCTATGTTTACTCTGCACCTTATTTCCATGTGATCCTCTGCATGG
CTCCATGTGGGCCCATACTTTCAACAGTGTTAACCGGGACCGTTGAACAGAACAAATCCGTACCCCGATCACTGA
TCTGCTCAAGATCAACCACCCCATCCTGCTGGCAGGCATGAACGTGGCTGCGGGGCCCAAGCTGGCCGCCGCTGT
CACCAACGCCGGTGGTCTGGGTGTGATCGGCGGTGTTGGCTACTCCCCCGAGATGCTACGCGAACAAATCGCCGA
ACTCAAGAGCTACCTTAACGACAAGAACGCTCCCTTCGGTGTCGACCTCCTCCTTCCCCAGGTTGGCGGTAGTGC
CCGCAAGACCAAGTAAGAACCTTCGCTGCGGTACTTTTCCGTTGTTGACACGTGCTAATCGCGTTTTGTTTCGGC
AAATAGCTACGACTACACCAAGGGCAAGCTCGGTGAGCTCGTTGATATTATTATCCAGGAGAAGGCTAGCCTTTT
CGTCTCCGCCGTCGGCGTCCCCCCCAAGGCTGTTGTCGACAAGCTCCACAGTGCCGGCATCCTCTGCATGAACAT
GATCGGCCACCCCAAGCACGTCCAGAAGGCCCTGGATGTTGGTATTGATATTATCTGCGCACAGGGTGGTGAGGG
CGGTGGTCACACCGGTGATGTCCCTACCACCATCCTCATCCCCACCGTTGCCAAGTTGGTCGAGGGCAAGAAGAG
CCCTCTGACCGGCCAGCCCGTGCAAGTCATCGCGGCCGGTGGTCTGTTCAACGGTAACTCGGTTGCTGCTGCTCT
GATGCTGGGTGCCTCCGCTGTCTGGATCGGTACCCGCTTCATCCTGGCTGATGAGGCTGGCGCCCCCGCCGCTCA
CCAGGAGGCCGTCCGCACTTCCAACTTCGAGGACAACATCCGTACCATTATCTTCACTGTATGTATCCCCAGCGA
TTTTATTATCACGGCGTCCGTGTTGCTAACAACCGATATAGGGACGTCCCCTCCGTGTTCGCAAGAACCCTTACA
TCGTCAACTGGGAGGAGAACCGTCACGATGAGATCAAGGAGCTCACCTCCAAGGGTATCATCCCTGTCGAGCACG
ATATGGAGAACTTGCCCGATGATGTCGATGACGAGACTTTGGACAATGCCCGTCCTTGGCTGATGGGCAAGGTTG
CCGCCGTTGTCAACGAGAAGAAGCCTGCCAAGGCTATCGTTGACGAGCTCGTCAGCGATGCCGCTGTCCTGCTCC
AGAAGGGCAACAAGATGGTTGCTAAGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail