Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7075.t1
Gene name
Locationscaffold_20:406239..407145
Strand-
Gene length (bp)906
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 4.5E-12 38 225

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 0.16 0.0 0.49
5d_25C Five days - 25 degrees Celsius 0.12 0.0 0.46
7d_25C Seven days - 25 degrees Celsius 0.32 0.0 0.85
10d_25C Ten days - 25 degrees Celsius 0.24 0.0 0.68
7d_15C Seven days - 15 degrees Celsius 0.10 0.0 0.40
7d_30C Seven days - 30 degrees Celsius 1.25 0.0 2.66

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 1.000000 no
3d_25C 7d_25C 1.000000 no
3d_25C 7d_15C 1.000000 no
3d_25C 7d_30C 0.188553 no
3d_25C 10d_25C 1.000000 no
5d_25C 7d_25C 1.000000 no
5d_25C 7d_15C 1.000000 no
5d_25C 7d_30C 0.258601 no
5d_25C 10d_25C 1.000000 no
7d_25C 7d_15C 1.000000 no
7d_25C 7d_30C 0.224627 no
7d_25C 10d_25C 1.000000 no
7d_15C 7d_30C 0.327237 no
7d_15C 10d_25C 1.000000 no
7d_30C 10d_25C 0.223614 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7075.t1
MIILTICVLAIAFGTIFARASPLSRPAKLNWSSTKALIAFGDSYTYVQGTIGHQNFSFIGDQFNLAYDAEALLSN
KIVQNQTATAEGGPNWVEYLTNCGIHQGLTSPQDCKKQLWDFAFAGADISTEYTPPHHNFTVSLLDQINQFKQYG
HPALLNSLPSFTQDKTLVAIWIGINDINDSAKYVVNFPTFYKSLIDTLFTSVEILYNLGYRNYLFMNLPPLDRTP
GNQATKDPSPNSGRVV*
Coding >Pro_DTO377G3_2|g7075.t1
ATGATTATCCTGACGATATGCGTCCTAGCCATCGCCTTTGGCACTATTTTCGCCAGAGCAAGTCCTCTGTCAAGA
CCCGCCAAACTCAACTGGTCATCGACTAAGGCTCTAATCGCCTTTGGTGACTCCTACACCTATGTCCAGGGAACC
ATCGGACACCAAAATTTCAGTTTCATTGGCGACCAATTCAACCTCGCATATGATGCCGAAGCCCTGCTTTCCAAC
AAGATAGTCCAAAATCAAACCGCAACCGCAGAAGGCGGTCCGAACTGGGTCGAATATCTCACAAACTGCGGCATC
CACCAAGGCCTCACCTCTCCACAAGACTGCAAAAAGCAACTCTGGGATTTCGCCTTTGCAGGCGCCGATATATCA
ACCGAGTACACACCACCACACCACAACTTCACAGTCTCCCTCCTAGACCAGATAAACCAATTCAAGCAATATGGC
CACCCAGCCCTCCTAAACAGTCTACCAAGCTTCACCCAAGACAAAACCCTAGTCGCCATCTGGATCGGCATCAAC
GACATAAACGACAGCGCCAAGTACGTCGTGAACTTCCCAACCTTCTACAAAAGCCTCATAGACACACTCTTCACA
TCAGTGGAAATCCTCTATAACCTGGGCTACAGAAACTATCTCTTCATGAACCTGCCGCCGCTAGACCGCACGCCA
GGGAACCAAGCAACGAAGGATCCGAGTCCGAATTCAGGTCGGGTGGTATAA
Transcript >Pro_DTO377G3_2|g7075.t1
ATGATTATCCTGACGATATGCGTCCTAGCCATCGCCTTTGGCACTATTTTCGCCAGAGCAAGTCCTCTGTCAAGA
CCCGCCAAACTCAACTGGTCATCGACTAAGGCTCTAATCGCCTTTGGTGACTCCTACACCTATGTCCAGGGAACC
ATCGGACACCAAAATTTCAGTTTCATTGGCGACCAATTCAACCTCGCATATGATGCCGAAGCCCTGCTTTCCAAC
AAGATAGTCCAAAATCAAACCGCAACCGCAGAAGGCGGTCCGAACTGGGTCGAATATCTCACAAACTGCGGCATC
CACCAAGGCCTCACCTCTCCACAAGACTGCAAAAAGCAACTCTGGGATTTCGCCTTTGCAGGCGCCGATATATCA
ACCGAGTACACACCACCACACCACAACTTCACAGTCTCCCTCCTAGACCAGATAAACCAATTCAAGCAATATGGC
CACCCAGCCCTCCTAAACAGTCTACCAAGCTTCACCCAAGACAAAACCCTAGTCGCCATCTGGATCGGCATCAAC
GACATAAACGACAGCGCCAAGTACGTCGTGAACTTCCCAACCTTCTACAAAAGCCTCATAGACACACTCTTCACA
TCAGTGGAAATCCTCTATAACCTGGGCTACAGAAACTATCTCTTCATGAACCTGCCGCCGCTAGACCGCACGCCA
GGGAACCAAGCAACGAAGGATCCGAGTCCGAATTCAGGTCGGGTGGTATAA
Gene >Pro_DTO377G3_2|g7075.t1
ATGATTATCCTGACGATATGCGTCCTAGCCATCGCCTTTGGCACTATTTTCGCCAGAGCAAGTCCTCTGTCAAGA
CCCGCCAAACTCAACTGGTCATCGACTAAGGCTCTGTGAGTATATCTAGCCTAAATCTTGCAAGCAGCACTGACC
CCAGACCAAAGAATCGCCTTTGGTGACTCCTACACCTATGTCCAGGGAACCATCGGACACCAAAATTTCAGTTTC
ATTGGCGACCAATTCAACCTCGCATATGATGCCGAAGCCCTGCTTTCCAACAAGATAGTCCAAAATCAAGTAAGC
TTATATCTTGACACGATTGAATCAAACACAGCACCACTCGGATATTAACGTCCCACGTCTAGACCGCAACCGCAG
AAGGCGGTCCGAACTGGGTCGAATATCTCACAAACTGCGGCATCCACCAAGGCCTCACCTCTCCACAAGACTGCA
AAAAGCAACTCTGGGATTTCGCCTTTGCAGGCGCCGATATATCAACCGAGTAGTAAGTACAAGCACAAGTACAAT
CAACACACATTTTCGAGCAAACTCAACTAAAAACCAAGCACACCACCACACCACAACTTCACAGTCTCCCTCCTA
GACCAGATAAACCAATTCAAGCAATATGGCCACCCAGCCCTCCTAAACAGTCTACCAAGCTTCACCCAAGACAAA
ACCCTAGTCGCCATCTGGATCGGCATCAACGACATAAACGACAGCGCCAAGTACGTCGTGAACTTCCCAACCTTC
TACAAAAGCCTCATAGACACACTCTTCACATCAGTGGAAATCCTCTATAACCTGGGCTACAGAAACTATCTCTTC
ATGAACCTGCCGCCGCTAGACCGCACGCCAGGGAACCAAGCAACGAAGGATCCGAGTCCGAATTCAGGTCGGGTG
GTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail