Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7071.t1
Gene name
Locationscaffold_20:395014..399617
Strand+
Gene length (bp)4603
Transcript length (bp)4386
Coding sequence length (bp)4386
Protein length (aa) 1462

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00136 DNA_pol_B DNA polymerase family B 1.8E-117 783 1228
PF08996 zf-DNA_Pol DNA Polymerase alpha zinc finger 9.7E-68 1267 1456
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 5.4E-44 374 716
PF12254 DNA_pol_alpha_N DNA polymerase alpha subunit p180 N terminal 9.7E-24 8 72

GO

GO Term Description Terminal node
GO:0001882 nucleoside binding Yes
GO:0006260 DNA replication Yes
GO:0003887 DNA-directed DNA polymerase activity Yes
GO:0003677 DNA binding Yes
GO:0000166 nucleotide binding Yes
GO:0071704 organic substance metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0044260 cellular macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0016740 transferase activity No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0016779 nucleotidyltransferase activity No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0044237 cellular metabolic process No
GO:0005488 binding No
GO:0006259 DNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0009058 biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034061 DNA polymerase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:1901576 organic substance biosynthetic process No
GO:0008150 biological_process No
GO:0140097 catalytic activity, acting on DNA No
GO:0008152 metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7071.t1
MPTARERLAELRALRASGKKRLSTYEVEDQGDIYDEVDDDGYKKVIRNRLDQDDFVVDDNGAGYADDGREVWNEQ
TAEYDSDESDELPTRGKAAKRKREEEQQRKEKINNGISKYFNKGQAAASVPKPKPAATAEDDAFMADLLGEVDTN
VVSNHAPTRNIVKSEARRKVRVLSPPLSEKRRREKLHAKDENHIPSSPMKDPALHSDDLDDGPLPMADDDDVPMS
DILPSSPIIKAVERRNTVPVKAEEPEDDDVDLMDVAEVTGDSSLKTKTINMTGSRPPPKIKREIAPTPASSSPVK
SMAEVMDASWNDVRSKLNVLSSPAPEMRSFGKLRAQDVVEEDGSLRIFWLDYTEVNGSLCLFGKVKNKQNGSYTS
AFVKIDNILRKLYFLPREYRYKQGRATEEEVDMQDVYSEVDEMMSRLKVGMHKMKPCERKYAFEMPGVPKEAEYL
KLLYPYDKAALPMETKGETFSNVFGTNTSLFEQFVLWKNIMGPCWLKIDQADFAAVTNASWCKFECQATKPALIS
LVPDSENLDAPPLTLMSLSFRTQLNVKENKQEILIASARVYEDVSLTDTTPPEKLPCKTFTVMRPAGGSYPMHFE
AEARNQQGTVILEKSEQFLLSKFLAMFEKMDPDVIMGHQLQDVDLGILLSRMREKKTPGWHRIGRLRRGDWPKNF
NKGGNFFAERQLIAGRLMCDVANDMGKSLMMKCQSWSLTEMCQLYLGQGNVRQELDAEAALKTWATTKEGLMNFV
NHCDTDTYFIAALVLRLQMLPLTKVLTNTAGNSWARTLSGTRAERNEYILLHEFHRNKYICPDKYSSRLQKAEEK
IQDGDDDEVVDKKKKDKFKGGLVFEPEKGLYDRFVLVMDFNSLYPSIIQEYNICFTTVDRTATAENENEEKVPDV
PSPDQEQGVLPRLIATLVSRRREVKKLMKDKRATPEQLAIWDTKQLALKLTANSMYGCLGYTQSRFYARPLAMLT
TFKGREILRNTKELAESQQLRVIYGDTDSVMINTNMDNMSDALKVGEEFKKSVNERYRLLEIDIDNIFRRLLLHA
KKKYAAINLTEVDGKYVEKLEVKGLDMKRREYCALSKEVSSKLLNEILSGEDQEIVLNNIHEYLRELADRMKEYK
IPVQKYVIYTKLSKRPQEYPNKESMPPAQVALREIARGKTVRPNDVISYIVTNGDSETSSLPPAKRSYTPQDVLK
PDSGLKPDVEFYMLKQIFPPIERLCAPIPGTDAVRLAECLGLDTRKYQINTSSSNSQQNAEVTPLESQIPDSVRF
ANSTRLSLICRYCKEQSVYEGLVTSSHMCTAHGIVCPNQSCQKPFSVMTIVAQVENQIRQQTSRYYEGWLVCDDS
SCGNRTRQISVYGHRCLGPRGRAEGCLGRMSYEYSEKEVYNQLLYFAGLWDVEKAKVAAEKETGEKKDSVAALAE
FNRTRFGTIKGVVDSYLKKCGRQWVEMDGLFRFMLQ*
Coding >Pro_DTO377G3_2|g7071.t1
ATGCCTACAGCCCGCGAAAGGTTGGCCGAGCTGAGGGCCCTCCGTGCCTCAGGAAAGAAACGACTTTCCACATAC
GAGGTTGAGGACCAGGGCGATATCTACGACGAGGTTGATGATGATGGCTACAAAAAGGTCATCCGAAATCGTCTT
GATCAGGATGATTTTGTCGTCGATGATAACGGTGCGGGTTACGCGGACGATGGCCGCGAGGTATGGAACGAACAG
ACAGCAGAATATGACAGTGACGAGAGCGACGAACTACCTACACGGGGCAAGGCTGCCAAACGAAAGAGAGAAGAG
GAACAACAGCGAAAGGAGAAAATTAACAATGGCATATCCAAGTACTTCAACAAAGGACAGGCTGCGGCTTCTGTT
CCCAAACCCAAGCCCGCTGCTACTGCCGAGGACGATGCATTCATGGCCGATCTTCTCGGAGAGGTCGACACCAAT
GTCGTATCGAATCACGCCCCGACACGAAACATTGTCAAATCAGAAGCCCGACGCAAAGTCCGCGTTCTCTCCCCG
CCTCTGTCTGAGAAGCGTCGCCGCGAGAAGCTTCACGCAAAAGACGAAAATCACATTCCAAGCTCGCCAATGAAG
GACCCGGCACTCCACTCTGACGATCTCGATGACGGCCCTCTACCGATGGCAGACGATGATGACGTTCCCATGAGC
GATATACTGCCCTCGTCTCCGATTATTAAAGCGGTGGAACGGAGGAACACTGTACCGGTCAAGGCCGAAGAGCCA
GAAGACGATGATGTTGACCTCATGGACGTCGCAGAAGTCACTGGAGACTCTAGCCTTAAAACGAAGACTATCAAC
ATGACCGGCAGTCGACCGCCCCCGAAGATCAAGCGTGAAATTGCTCCTACACCAGCAAGCTCGTCCCCAGTCAAG
TCAATGGCAGAAGTAATGGATGCTTCTTGGAATGACGTGAGGAGCAAATTGAACGTCCTCAGTAGTCCAGCTCCG
GAAATGCGATCATTTGGAAAGCTGCGCGCCCAGGATGTTGTCGAAGAGGACGGCAGTCTGCGCATATTCTGGCTG
GACTACACGGAAGTCAACGGCAGCTTGTGTCTGTTCGGAAAAGTGAAGAACAAGCAGAATGGATCATACACCAGT
GCATTCGTTAAGATTGACAATATCTTGCGAAAGCTCTATTTCCTGCCGCGTGAATATCGATACAAGCAAGGACGA
GCGACGGAAGAGGAGGTTGACATGCAAGATGTTTACTCAGAGGTCGACGAGATGATGTCAAGACTGAAAGTCGGC
ATGCACAAGATGAAACCGTGCGAACGGAAGTACGCATTTGAAATGCCCGGGGTCCCAAAGGAAGCGGAGTATCTC
AAATTACTCTACCCCTACGATAAGGCTGCACTGCCAATGGAAACTAAGGGAGAGACTTTCTCAAACGTTTTCGGT
ACCAATACCTCCCTGTTTGAACAGTTTGTTCTCTGGAAAAATATAATGGGCCCTTGCTGGCTCAAGATCGATCAG
GCAGACTTTGCTGCAGTAACCAATGCATCCTGGTGCAAGTTCGAATGCCAGGCCACCAAACCAGCTCTCATCAGC
CTCGTCCCAGATTCCGAGAACCTGGATGCCCCGCCCTTGACCTTAATGAGTCTTTCTTTCCGTACCCAGCTCAAT
GTCAAGGAGAACAAGCAGGAGATTCTAATAGCAAGTGCCCGGGTGTATGAAGACGTTTCTCTGACTGATACCACT
CCACCAGAGAAGCTTCCGTGCAAGACATTCACCGTCATGCGCCCTGCTGGTGGATCATACCCAATGCATTTTGAA
GCCGAAGCACGAAATCAGCAAGGAACTGTCATTCTTGAAAAAAGCGAACAGTTCTTGCTCAGTAAATTCCTGGCT
ATGTTCGAGAAGATGGACCCCGATGTGATCATGGGCCATCAGTTGCAGGATGTCGACCTGGGCATTCTACTCAGC
CGGATGCGGGAAAAGAAGACGCCTGGATGGCATCGTATTGGCCGACTCAGGCGTGGAGATTGGCCTAAGAATTTC
AACAAGGGTGGCAACTTCTTCGCCGAAAGACAGTTGATTGCTGGAAGATTGATGTGTGATGTTGCCAATGACATG
GGCAAGTCTCTTATGATGAAATGTCAATCATGGAGTTTGACTGAGATGTGCCAACTCTACCTCGGTCAAGGCAAT
GTACGCCAGGAACTGGATGCCGAAGCGGCACTGAAAACCTGGGCGACCACCAAAGAAGGTCTCATGAATTTTGTC
AATCATTGTGATACAGATACATACTTCATTGCGGCATTGGTTTTACGTCTTCAGATGCTGCCACTTACGAAGGTC
CTAACCAATACCGCGGGTAATTCGTGGGCACGCACACTTAGCGGTACGCGTGCCGAGCGCAACGAGTATATTTTG
TTACATGAGTTTCATCGCAACAAATACATCTGTCCGGACAAGTACTCGTCTCGTCTTCAGAAGGCAGAGGAGAAA
ATACAAGATGGCGACGATGATGAGGTGGTCGACAAGAAAAAGAAGGACAAATTCAAGGGCGGTCTTGTTTTCGAG
CCCGAAAAAGGTCTTTACGACCGCTTCGTCCTTGTTATGGACTTCAACAGTCTGTATCCCAGTATTATTCAGGAA
TACAACATCTGCTTCACAACAGTGGACCGAACAGCTACGGCCGAGAATGAGAATGAAGAAAAAGTGCCAGATGTC
CCCTCCCCTGACCAAGAACAAGGCGTTCTACCTCGGTTGATCGCGACGTTGGTTAGTCGTCGACGCGAAGTGAAG
AAGTTGATGAAAGACAAGCGTGCCACACCCGAACAACTGGCCATATGGGACACAAAACAATTGGCATTGAAGCTG
ACTGCCAATTCCATGTACGGATGCTTGGGATACACACAGAGTCGATTTTACGCTCGTCCTTTGGCAATGCTCACC
ACTTTTAAGGGACGTGAAATTCTGAGAAACACCAAGGAATTGGCCGAAAGCCAGCAATTGCGAGTCATTTATGGT
GACACCGATTCGGTCATGATCAATACGAATATGGACAACATGAGTGACGCCCTCAAGGTTGGCGAAGAGTTCAAG
AAATCGGTCAACGAACGTTACCGACTTCTAGAAATCGATATCGACAATATCTTCCGTCGGCTTCTACTACATGCC
AAGAAGAAGTACGCTGCTATCAACCTTACCGAGGTGGATGGCAAGTACGTGGAGAAACTTGAGGTCAAGGGTCTT
GACATGAAGCGTCGTGAATACTGTGCCCTCTCAAAGGAGGTATCATCAAAGCTACTCAACGAAATCTTGTCCGGT
GAAGATCAGGAAATCGTTCTCAACAACATTCACGAGTACTTGCGTGAGCTTGCAGACAGGATGAAGGAATATAAA
ATCCCGGTGCAGAAATACGTGATATACACCAAACTTTCAAAACGACCCCAGGAGTACCCTAATAAAGAGAGCATG
CCACCGGCACAAGTCGCTCTCCGCGAAATTGCCCGGGGCAAGACAGTTAGACCGAACGACGTCATCTCGTATATT
GTGACCAACGGAGACTCTGAAACCTCATCTCTCCCTCCTGCGAAGCGATCATACACCCCGCAGGATGTGCTGAAG
CCCGATTCAGGGCTCAAGCCAGATGTTGAGTTCTACATGCTCAAGCAAATATTCCCTCCAATTGAGCGTCTCTGC
GCCCCAATTCCTGGCACCGATGCCGTTCGTCTTGCCGAGTGCTTGGGTCTTGATACTCGCAAATATCAGATCAAT
ACCTCCAGTTCCAACAGTCAGCAAAACGCCGAGGTCACCCCGCTCGAGTCCCAGATCCCGGACTCGGTTCGGTTT
GCCAATTCTACGCGACTGTCCCTAATATGCCGATACTGCAAAGAACAATCTGTGTATGAGGGTCTGGTGACCTCA
TCGCACATGTGCACTGCGCACGGAATCGTTTGTCCGAACCAGAGCTGCCAGAAACCCTTCTCGGTTATGACAATT
GTCGCCCAAGTGGAGAACCAAATCCGCCAACAGACTTCGCGATACTATGAAGGCTGGTTGGTCTGTGACGATTCG
TCATGTGGCAATCGCACACGGCAAATCAGCGTTTATGGACACCGCTGCTTGGGTCCCCGAGGTCGTGCAGAAGGC
TGTCTAGGTCGCATGTCGTACGAGTACTCGGAGAAAGAGGTATACAACCAGCTTCTCTACTTTGCCGGTCTCTGG
GATGTCGAAAAAGCTAAGGTCGCTGCCGAGAAAGAGACAGGAGAAAAGAAGGACAGTGTTGCCGCCCTTGCAGAG
TTCAATCGCACAAGATTCGGTACGATCAAGGGGGTGGTAGATAGCTACCTGAAGAAGTGTGGTCGTCAATGGGTT
GAGATGGATGGTCTCTTCCGCTTCATGTTACAATAG
Transcript >Pro_DTO377G3_2|g7071.t1
ATGCCTACAGCCCGCGAAAGGTTGGCCGAGCTGAGGGCCCTCCGTGCCTCAGGAAAGAAACGACTTTCCACATAC
GAGGTTGAGGACCAGGGCGATATCTACGACGAGGTTGATGATGATGGCTACAAAAAGGTCATCCGAAATCGTCTT
GATCAGGATGATTTTGTCGTCGATGATAACGGTGCGGGTTACGCGGACGATGGCCGCGAGGTATGGAACGAACAG
ACAGCAGAATATGACAGTGACGAGAGCGACGAACTACCTACACGGGGCAAGGCTGCCAAACGAAAGAGAGAAGAG
GAACAACAGCGAAAGGAGAAAATTAACAATGGCATATCCAAGTACTTCAACAAAGGACAGGCTGCGGCTTCTGTT
CCCAAACCCAAGCCCGCTGCTACTGCCGAGGACGATGCATTCATGGCCGATCTTCTCGGAGAGGTCGACACCAAT
GTCGTATCGAATCACGCCCCGACACGAAACATTGTCAAATCAGAAGCCCGACGCAAAGTCCGCGTTCTCTCCCCG
CCTCTGTCTGAGAAGCGTCGCCGCGAGAAGCTTCACGCAAAAGACGAAAATCACATTCCAAGCTCGCCAATGAAG
GACCCGGCACTCCACTCTGACGATCTCGATGACGGCCCTCTACCGATGGCAGACGATGATGACGTTCCCATGAGC
GATATACTGCCCTCGTCTCCGATTATTAAAGCGGTGGAACGGAGGAACACTGTACCGGTCAAGGCCGAAGAGCCA
GAAGACGATGATGTTGACCTCATGGACGTCGCAGAAGTCACTGGAGACTCTAGCCTTAAAACGAAGACTATCAAC
ATGACCGGCAGTCGACCGCCCCCGAAGATCAAGCGTGAAATTGCTCCTACACCAGCAAGCTCGTCCCCAGTCAAG
TCAATGGCAGAAGTAATGGATGCTTCTTGGAATGACGTGAGGAGCAAATTGAACGTCCTCAGTAGTCCAGCTCCG
GAAATGCGATCATTTGGAAAGCTGCGCGCCCAGGATGTTGTCGAAGAGGACGGCAGTCTGCGCATATTCTGGCTG
GACTACACGGAAGTCAACGGCAGCTTGTGTCTGTTCGGAAAAGTGAAGAACAAGCAGAATGGATCATACACCAGT
GCATTCGTTAAGATTGACAATATCTTGCGAAAGCTCTATTTCCTGCCGCGTGAATATCGATACAAGCAAGGACGA
GCGACGGAAGAGGAGGTTGACATGCAAGATGTTTACTCAGAGGTCGACGAGATGATGTCAAGACTGAAAGTCGGC
ATGCACAAGATGAAACCGTGCGAACGGAAGTACGCATTTGAAATGCCCGGGGTCCCAAAGGAAGCGGAGTATCTC
AAATTACTCTACCCCTACGATAAGGCTGCACTGCCAATGGAAACTAAGGGAGAGACTTTCTCAAACGTTTTCGGT
ACCAATACCTCCCTGTTTGAACAGTTTGTTCTCTGGAAAAATATAATGGGCCCTTGCTGGCTCAAGATCGATCAG
GCAGACTTTGCTGCAGTAACCAATGCATCCTGGTGCAAGTTCGAATGCCAGGCCACCAAACCAGCTCTCATCAGC
CTCGTCCCAGATTCCGAGAACCTGGATGCCCCGCCCTTGACCTTAATGAGTCTTTCTTTCCGTACCCAGCTCAAT
GTCAAGGAGAACAAGCAGGAGATTCTAATAGCAAGTGCCCGGGTGTATGAAGACGTTTCTCTGACTGATACCACT
CCACCAGAGAAGCTTCCGTGCAAGACATTCACCGTCATGCGCCCTGCTGGTGGATCATACCCAATGCATTTTGAA
GCCGAAGCACGAAATCAGCAAGGAACTGTCATTCTTGAAAAAAGCGAACAGTTCTTGCTCAGTAAATTCCTGGCT
ATGTTCGAGAAGATGGACCCCGATGTGATCATGGGCCATCAGTTGCAGGATGTCGACCTGGGCATTCTACTCAGC
CGGATGCGGGAAAAGAAGACGCCTGGATGGCATCGTATTGGCCGACTCAGGCGTGGAGATTGGCCTAAGAATTTC
AACAAGGGTGGCAACTTCTTCGCCGAAAGACAGTTGATTGCTGGAAGATTGATGTGTGATGTTGCCAATGACATG
GGCAAGTCTCTTATGATGAAATGTCAATCATGGAGTTTGACTGAGATGTGCCAACTCTACCTCGGTCAAGGCAAT
GTACGCCAGGAACTGGATGCCGAAGCGGCACTGAAAACCTGGGCGACCACCAAAGAAGGTCTCATGAATTTTGTC
AATCATTGTGATACAGATACATACTTCATTGCGGCATTGGTTTTACGTCTTCAGATGCTGCCACTTACGAAGGTC
CTAACCAATACCGCGGGTAATTCGTGGGCACGCACACTTAGCGGTACGCGTGCCGAGCGCAACGAGTATATTTTG
TTACATGAGTTTCATCGCAACAAATACATCTGTCCGGACAAGTACTCGTCTCGTCTTCAGAAGGCAGAGGAGAAA
ATACAAGATGGCGACGATGATGAGGTGGTCGACAAGAAAAAGAAGGACAAATTCAAGGGCGGTCTTGTTTTCGAG
CCCGAAAAAGGTCTTTACGACCGCTTCGTCCTTGTTATGGACTTCAACAGTCTGTATCCCAGTATTATTCAGGAA
TACAACATCTGCTTCACAACAGTGGACCGAACAGCTACGGCCGAGAATGAGAATGAAGAAAAAGTGCCAGATGTC
CCCTCCCCTGACCAAGAACAAGGCGTTCTACCTCGGTTGATCGCGACGTTGGTTAGTCGTCGACGCGAAGTGAAG
AAGTTGATGAAAGACAAGCGTGCCACACCCGAACAACTGGCCATATGGGACACAAAACAATTGGCATTGAAGCTG
ACTGCCAATTCCATGTACGGATGCTTGGGATACACACAGAGTCGATTTTACGCTCGTCCTTTGGCAATGCTCACC
ACTTTTAAGGGACGTGAAATTCTGAGAAACACCAAGGAATTGGCCGAAAGCCAGCAATTGCGAGTCATTTATGGT
GACACCGATTCGGTCATGATCAATACGAATATGGACAACATGAGTGACGCCCTCAAGGTTGGCGAAGAGTTCAAG
AAATCGGTCAACGAACGTTACCGACTTCTAGAAATCGATATCGACAATATCTTCCGTCGGCTTCTACTACATGCC
AAGAAGAAGTACGCTGCTATCAACCTTACCGAGGTGGATGGCAAGTACGTGGAGAAACTTGAGGTCAAGGGTCTT
GACATGAAGCGTCGTGAATACTGTGCCCTCTCAAAGGAGGTATCATCAAAGCTACTCAACGAAATCTTGTCCGGT
GAAGATCAGGAAATCGTTCTCAACAACATTCACGAGTACTTGCGTGAGCTTGCAGACAGGATGAAGGAATATAAA
ATCCCGGTGCAGAAATACGTGATATACACCAAACTTTCAAAACGACCCCAGGAGTACCCTAATAAAGAGAGCATG
CCACCGGCACAAGTCGCTCTCCGCGAAATTGCCCGGGGCAAGACAGTTAGACCGAACGACGTCATCTCGTATATT
GTGACCAACGGAGACTCTGAAACCTCATCTCTCCCTCCTGCGAAGCGATCATACACCCCGCAGGATGTGCTGAAG
CCCGATTCAGGGCTCAAGCCAGATGTTGAGTTCTACATGCTCAAGCAAATATTCCCTCCAATTGAGCGTCTCTGC
GCCCCAATTCCTGGCACCGATGCCGTTCGTCTTGCCGAGTGCTTGGGTCTTGATACTCGCAAATATCAGATCAAT
ACCTCCAGTTCCAACAGTCAGCAAAACGCCGAGGTCACCCCGCTCGAGTCCCAGATCCCGGACTCGGTTCGGTTT
GCCAATTCTACGCGACTGTCCCTAATATGCCGATACTGCAAAGAACAATCTGTGTATGAGGGTCTGGTGACCTCA
TCGCACATGTGCACTGCGCACGGAATCGTTTGTCCGAACCAGAGCTGCCAGAAACCCTTCTCGGTTATGACAATT
GTCGCCCAAGTGGAGAACCAAATCCGCCAACAGACTTCGCGATACTATGAAGGCTGGTTGGTCTGTGACGATTCG
TCATGTGGCAATCGCACACGGCAAATCAGCGTTTATGGACACCGCTGCTTGGGTCCCCGAGGTCGTGCAGAAGGC
TGTCTAGGTCGCATGTCGTACGAGTACTCGGAGAAAGAGGTATACAACCAGCTTCTCTACTTTGCCGGTCTCTGG
GATGTCGAAAAAGCTAAGGTCGCTGCCGAGAAAGAGACAGGAGAAAAGAAGGACAGTGTTGCCGCCCTTGCAGAG
TTCAATCGCACAAGATTCGGTACGATCAAGGGGGTGGTAGATAGCTACCTGAAGAAGTGTGGTCGTCAATGGGTT
GAGATGGATGGTCTCTTCCGCTTCATGTTACAATAG
Gene >Pro_DTO377G3_2|g7071.t1
ATGCCTACAGCCCGCGAAAGGTTGGCCGAGCTGAGGGCCCTCCGTGCCTCAGGAAAGAAACGACTTTCCACATAC
GAGGTTGAGGACCAGGGCGATATCTACGACGAGGTTGATGATGATGGCTACAAAAAGGTCATCCGAAATCGTCTT
GATCAGGATGATTTTGTCGTCGATGATAACGGTGCGGGTTACGCGGACGATGGCCGCGAGGTATGGAACGAACAG
ACAGCAGAATATGACAGTGACGAGAGCGACGAACTACCTACACGGGGCAAGGCTGCCAAACGAAAGAGAGAAGAG
GAACAACAGCGAAAGGAGAAAATTAACAATGGCATATCCAAGTACTTCAACAAAGGACAGGCTGCGGCTTCTGTT
CCCAAACCCAAGGTGAGTGCTTTTTGCTCGTGGAATCCAACCACCTTATTTTGACAAGTGTTTTACAAGCCCGCT
GCTACTGCCGAGGACGATGCATTCATGGCCGATCTTCTCGGAGAGGTCGACACCAATGTCGTATCGAATCACGCC
CCGACACGAAACATTGTCAAATCAGAAGCCCGACGCAAAGTCCGCGTTCTCTCCCCGCCTCTGTCTGAGAAGCGT
CGCCGCGAGAAGCTTCACGCAAAAGACGAAAATCACATTCCAAGCTCGCCAATGAAGGACCCGGCACTCCACTCT
GACGATCTCGATGACGGCCCTCTACCGATGGCAGACGATGATGACGTTCCCATGAGCGATATACTGCCCTCGTCT
CCGATTATTAAAGCGGTGGAACGGAGGAACACTGTACCGGTCAAGGCCGAAGAGCCAGAAGACGATGATGTTGAC
CTCATGGACGTCGCAGAAGTCACTGGAGACTCTAGCCTTAAAACGAAGACTATCAACATGACCGGCAGTCGACCG
CCCCCGAAGATCAAGCGTGAAATTGCTCCTACACCAGCAAGCTCGTCCCCAGTCAAGTCAATGGCAGAAGTAATG
GATGCTTCTTGGAATGACGTGAGGAGCAAATTGAACGTCCTCAGTAGTCCAGCTCCGGAAATGCGATCATTTGGA
AAGCTGCGCGCCCAGGATGTTGTCGAAGAGGACGGCAGTCTGCGCATATTCTGGCTGGACTACACGGAAGTCAAC
GGCAGCTTGTGTCTGTTCGGAAAAGTGAAGAACAAGCAGAATGGATCATACACCAGTGCATTCGTTAAGATTGAC
AATATCTTGCGAAAGCTCTATTTCCTGCCGCGTGAATATCGATACAAGCAAGGACGAGCGACGGAAGAGGAGGTT
GACATGCAAGATGTTTACTCAGAGGTCGACGAGATGATGTCAAGACTGAAAGTCGGCATGCACAAGATGAAACCG
TGCGAACGGAAGTACGCATTTGAAATGCCCGGGGTCCCAAAGGAAGCGGAGTATCTCAAATTACTCTACCCCTAC
GATAAGGCTGCACTGCCAATGGAAACTAAGGGAGAGACTTTCTCAAACGTTTTCGGTACCAATACCTCCCTGTTT
GAACAGTTTGTTCTCTGGAAAAATATAATGGGCCCTTGCTGGCTCAAGATCGATCAGGCAGACTTTGCTGCAGTA
ACCAATGCATCCTGGTGCAAGTTCGAATGCCAGGCCACCAAACCAGCTCTCATCAGCCTCGTCCCAGATTCCGAG
AACCTGGATGCCCCGCCCTTGACCTTAATGAGTCTTTCTTTCCGTACCCAGCTCAATGTCAAGGAGAACAAGCAG
GAGATTCTAATAGCAAGTGCCCGGGTGTATGAAGACGTTTCTCTGACTGATACCACTCCACCAGAGAAGCTTCCG
TGCAAGACATTCACCGTCATGCGCCCTGCTGGTGGATCATACCCAATGCATTTTGAAGCCGAAGCACGAAATCAG
CAAGGAACTGTCATTCTTGAAAAAAGCGAACAGTTCTTGCTCAGTAAATTCCTGGCTATGTTCGAGAAGATGGAC
CCCGATGTGATCATGGGCCATCAGTTGCAGGATGTCGACCTGGGCATTCTACTCAGCCGGATGCGGGAAAAGAAG
ACGCCTGGATGGCATCGTATTGGCCGACTCAGGCGTGGAGATTGGCCTAAGAATTTCAACAAGGGTGGCAACTTC
TTCGCCGAAAGACAGTTGATTGCTGGAAGATTGATGTGTGATGTTGCCAATGACATGGGCAAGGTAATTTTCTCC
TCAAAGTGGGTACATCACAATGCTGACAGCTACTAGTCTCTTATGATGAAATGTCAATCATGGAGTTTGACTGAG
ATGTGCCAACTCTACCTCGGTCAAGGCAATGTACGCCAGGAACTGGATGCCGAAGCGGCACTGAAAACCTGGGCG
ACCACCAAAGAAGGTCTCATGAATTTTGTCAATCATTGTGATACAGATACATACTTCATTGCGGCATTGGTTTTA
CGTCTTCAGATGCTGCCACTTACGAAGGTCCTAACCAATACCGCGGGTAATTCGTGGGCACGCACACTTAGCGGT
ACGCGTGCCGAGCGCAACGAGTATATTTTGTTACATGAGTTTCATCGCAACAAATACATCTGTCCGGACAAGTAC
TCGTCTCGTCTTCAGAAGGCAGAGGAGAAAATACAAGATGGCGACGATGATGAGGTGGTCGACAAGAAAAAGAAG
GACAAATTCAAGGGCGGTCTTGTTTTCGAGCCCGAAAAAGGTCTTTACGACCGCTTCGTCCTTGTTATGGACTTC
AACAGTCTGTATCCCAGTATTATTCAGGAATACAACATCTGCTTCACAACAGTGGACCGAACAGCTACGGTAAAT
TAACCCAACCAACCCCTAGTCTTGTTTCCTCTATTTCTAACATTTGCAACTAGGCCGAGAATGAGAATGAAGAAA
AAGTGCCAGATGTCCCCTCCCCTGACCAAGAACAAGGCGTTCTACCTCGGTTGATCGCGACGTTGGTTAGTCGTC
GACGCGAAGTGAAGAAGTTGATGAAAGACAAGCGTGCCACACCCGAACAACTGGCCATATGGGACACAAAACAAT
TGGCATTGAAGCTGACTGCCAATTCCATGTACGGATGCTTGGGATACACACAGAGTCGATTTTACGCTCGTCCTT
TGGCAATGCTCACCACTTTTAAGGGACGTGAAATTCTGAGAAACACCAAGGAATTGGCCGAAAGCCAGCAATTGC
GAGTCATTTATGGTGACACCGATTCGGTCATGATCAATACGAATATGGACAACATGAGTGACGCCCTCAAGGTTG
GCGAAGAGTTCAAGAAATCGGTCAACGAACGTTACCGACTTCTAGAAATCGATATCGACAATATCTTCCGTCGGC
TTCTACTACATGCCAAGAAGAAGTACGCTGCTATCAACCTTACCGAGGTGGATGGCAAGTACGTGGAGAAACTTG
AGGTCAAGGGTCTTGACATGAAGCGTCGTGAATACTGTGCCCTCTCAAAGGAGGTATCATCAAAGCTACTCAACG
AAATCTTGTCCGGTGAAGATCAGGAAATCGTTCTCAACAACATTCACGAGTACTTGCGTGAGCTTGCAGACAGGA
TGAAGGAATATAAAATCCCGGTGCAGAAATACGTGATATACACCGTATGTGATGAACCTGAAGAATTTTCTGGAT
CACCTTGCTAACGCTCTATCAGAAACTTTCAAAACGACCCCAGGAGTACCCTAATAAAGAGAGCATGCCACCGGC
ACAAGTCGCTCTCCGCGAAATTGCCCGGGGCAAGACAGTTAGACCGAACGACGTCATCTCGTATATTGTGACCAA
CGGAGACTCTGAAACCTCATCTCTCCCTCCTGCGAAGCGATCATACACCCCGCAGGATGTGCTGAAGCCCGATTC
AGGGCTCAAGCCAGATGTTGAGTTCTACATGCTCAAGCAAATATTCCCTCCAATTGAGCGTCTCTGCGCCCCAAT
TCCTGGCACCGATGCCGTTCGTCTTGCCGAGTGCTTGGGTCTTGATACTCGCAAATATCAGATCAATACCTCCAG
TTCCAACAGTCAGCAAAACGCCGAGGTCACCCCGCTCGAGTCCCAGATCCCGGACTCGGTTCGGTTTGCCAATTC
TACGCGACTGTCCCTAATATGCCGATACTGCAAAGAACAATCTGTGTATGAGGGTCTGGTGACCTCATCGCACAT
GTGCACTGCGCACGGAATCGTTTGTCCGAACCAGAGCTGCCAGAAACCCTTCTCGGTTATGACAATTGTCGCCCA
AGTGGAGAACCAAATCCGCCAACAGACTTCGCGATACTATGAAGGCTGGTTGGTCTGTGACGATTCGTCATGTGG
CAATCGCACACGGCAAATCAGCGTTTATGGACACCGCTGCTTGGGTCCCCGAGGTCGTGCAGAAGGCTGTCTAGG
TCGCATGTCGTACGAGTACTCGGAGAAAGAGGTATACAACCAGCTTCTCTACTTTGCCGGTCTCTGGGATGTCGA
AAAAGCTAAGGTCGCTGCCGAGAAAGAGACAGGAGAAAAGAAGGACAGTGTTGCCGCCCTTGCAGAGTTCAATCG
CACAAGATTCGGTACGATCAAGGGGGTGGTAGATAGCTACCTGAAGAAGTGTGGTCGTCAATGGGTTGAGATGGA
TGGTCTCTTCCGCTTCATGTTACAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail