Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7066.t1
Gene name
Locationscaffold_20:378994..380404
Strand-
Gene length (bp)1410
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04371 PAD_porph Porphyromonas-type peptidyl-arginine deiminase 1.8E-94 70 449

GO

GO Term Description Terminal node
GO:0009446 putrescine biosynthetic process Yes
GO:0004668 protein-arginine deiminase activity Yes
GO:0097164 ammonium ion metabolic process No
GO:0009309 amine biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009308 amine metabolic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0009445 putrescine metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044106 cellular amine metabolic process No
GO:0009987 cellular process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006576 cellular biogenic amine metabolic process No
GO:0044237 cellular metabolic process No
GO:0016813 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0006595 polyamine metabolic process No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0042401 cellular biogenic amine biosynthetic process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006596 polyamine biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7066.t1
MALLHSIQRLRQASTTISLARPHLPVIYQYKPPFQPTHPTATMPPTNKIWHIQHRALSLQADRAKQYIRPAETST
HLATLLSFPSRRSTLPELHAKTSNEIISLATTIAAFEPVHLYARSEDIPQAQALLDKQPQHRSNIILIAAPTNHC
WIRDTGPVYVHSADPADKTRYAIDFRFCEWGHKTTEYIYGANASPAAAEALETSPQYAEWPVMDAQAMSENTAFA
GVVLDLENAGADTVADVVVRVETDIRLEGGGIEVDGEGTFMATESSIIGDARNPGLGKAEIEAELRRLLGVSTFI
WFPGRVGLDVTDLHVDAEARFVRPGVVVVCRPHEKAEKVRWEVYSEIRAVLERSTDARGRRFEVHDVVEPDPSFV
QGGLAGEEEASAASYVNFYFVNGGLVIPAFGDPEADEKAFELMKSLVPGREVRQVEVNALPRTGGVLHCVTQQVV
*
Coding >Pro_DTO377G3_2|g7066.t1
ATGGCACTTCTTCACTCGATCCAACGACTAAGACAAGCATCTACCACTATCTCCTTAGCTCGACCTCACCTACCG
GTCATATACCAATACAAACCCCCATTCCAACCAACCCACCCAACAGCAACCATGCCGCCCACCAACAAAATCTGG
CACATCCAGCACCGCGCCCTCTCACTCCAAGCAGACAGAGCAAAGCAATACATCCGCCCAGCAGAAACAAGCACC
CACCTAGCAACCCTCCTAAGCTTCCCCTCCCGCCGCTCGACCCTCCCAGAGCTACACGCCAAAACAAGCAACGAG
ATAATCTCCCTCGCGACCACAATCGCAGCCTTCGAACCCGTGCACCTCTACGCCCGATCTGAAGACATCCCACAA
GCCCAAGCCCTCCTCGACAAACAACCCCAGCACCGGTCCAACATAATCCTCATCGCAGCGCCAACAAACCACTGC
TGGATCCGCGACACAGGCCCCGTCTACGTCCACAGCGCCGACCCAGCAGACAAAACCCGCTACGCAATCGACTTC
CGCTTCTGCGAATGGGGCCACAAAACCACAGAATACATCTACGGCGCCAACGCCTCGCCCGCAGCAGCAGAGGCG
CTCGAAACATCCCCGCAATACGCCGAGTGGCCGGTAATGGACGCGCAAGCCATGAGCGAGAACACGGCGTTCGCG
GGCGTCGTGCTGGATCTCGAGAATGCGGGCGCGGACACGGTGGCGGATGTTGTCGTGCGGGTGGAGACGGATATC
CGGCTCGAGGGCGGGGGTATTGAGGTCGACGGCGAGGGGACGTTCATGGCGACGGAGAGTAGTATTATTGGCGAT
GCGCGCAATCCTGGACTCGGGAAGGCGGAGATCGAGGCGGAGCTTCGTCGGTTGCTAGGTGTCAGTACGTTCATT
TGGTTCCCCGGGAGGGTGGGGCTCGATGTTACGGATTTGCATGTTGATGCTGAGGCGAGGTTTGTGAGACCTGGG
GTTGTGGTTGTTTGTCGTCCGCATGAGAAGGCGGAGAAGGTGCGTTGGGAGGTCTATTCGGAGATTCGGGCCGTC
TTGGAGAGATCTACTGATGCGCGTGGTCGGCGCTTTGAGGTTCATGATGTTGTTGAGCCGGATCCGAGCTTCGTT
CAGGGGGGTCTTGCTGGGGAGGAGGAGGCGTCGGCGGCTTCGTATGTGAACTTTTACTTTGTTAATGGTGGACTG
GTTATCCCGGCGTTTGGGGATCCTGAGGCTGATGAGAAGGCCTTTGAGTTGATGAAGAGCCTGGTTCCCGGGAGG
GAGGTTCGTCAGGTTGAGGTCAATGCCTTGCCTAGGACTGGAGGTGTGCTGCATTGTGTTACACAGCAGGTGGTG
TGA
Transcript >Pro_DTO377G3_2|g7066.t1
ATGGCACTTCTTCACTCGATCCAACGACTAAGACAAGCATCTACCACTATCTCCTTAGCTCGACCTCACCTACCG
GTCATATACCAATACAAACCCCCATTCCAACCAACCCACCCAACAGCAACCATGCCGCCCACCAACAAAATCTGG
CACATCCAGCACCGCGCCCTCTCACTCCAAGCAGACAGAGCAAAGCAATACATCCGCCCAGCAGAAACAAGCACC
CACCTAGCAACCCTCCTAAGCTTCCCCTCCCGCCGCTCGACCCTCCCAGAGCTACACGCCAAAACAAGCAACGAG
ATAATCTCCCTCGCGACCACAATCGCAGCCTTCGAACCCGTGCACCTCTACGCCCGATCTGAAGACATCCCACAA
GCCCAAGCCCTCCTCGACAAACAACCCCAGCACCGGTCCAACATAATCCTCATCGCAGCGCCAACAAACCACTGC
TGGATCCGCGACACAGGCCCCGTCTACGTCCACAGCGCCGACCCAGCAGACAAAACCCGCTACGCAATCGACTTC
CGCTTCTGCGAATGGGGCCACAAAACCACAGAATACATCTACGGCGCCAACGCCTCGCCCGCAGCAGCAGAGGCG
CTCGAAACATCCCCGCAATACGCCGAGTGGCCGGTAATGGACGCGCAAGCCATGAGCGAGAACACGGCGTTCGCG
GGCGTCGTGCTGGATCTCGAGAATGCGGGCGCGGACACGGTGGCGGATGTTGTCGTGCGGGTGGAGACGGATATC
CGGCTCGAGGGCGGGGGTATTGAGGTCGACGGCGAGGGGACGTTCATGGCGACGGAGAGTAGTATTATTGGCGAT
GCGCGCAATCCTGGACTCGGGAAGGCGGAGATCGAGGCGGAGCTTCGTCGGTTGCTAGGTGTCAGTACGTTCATT
TGGTTCCCCGGGAGGGTGGGGCTCGATGTTACGGATTTGCATGTTGATGCTGAGGCGAGGTTTGTGAGACCTGGG
GTTGTGGTTGTTTGTCGTCCGCATGAGAAGGCGGAGAAGGTGCGTTGGGAGGTCTATTCGGAGATTCGGGCCGTC
TTGGAGAGATCTACTGATGCGCGTGGTCGGCGCTTTGAGGTTCATGATGTTGTTGAGCCGGATCCGAGCTTCGTT
CAGGGGGGTCTTGCTGGGGAGGAGGAGGCGTCGGCGGCTTCGTATGTGAACTTTTACTTTGTTAATGGTGGACTG
GTTATCCCGGCGTTTGGGGATCCTGAGGCTGATGAGAAGGCCTTTGAGTTGATGAAGAGCCTGGTTCCCGGGAGG
GAGGTTCGTCAGGTTGAGGTCAATGCCTTGCCTAGGACTGGAGGTGTGCTGCATTGTGTTACACAGCAGGTGGTG
TGA
Gene >Pro_DTO377G3_2|g7066.t1
ATGGCACTTCTTCACTCGATCCAACGACTAAGACAAGCATCTACCACTGTCAGTACATCAGTCTGTCGCATTCTG
TACCACACACATGTGATCTAACCCATCCAGATCTCCTTAGCTCGACCTCACCTACCGGTCATATACCAATACAAA
CCCCCATTCCAACCAACCCACCCAACAGCAACCATGCCGCCCACCAACAAAATCTGGCACATCCAGCACCGCGCC
CTCTCACTCCAAGCAGACAGAGCAAAGCAATACATCCGCCCAGCAGAAACAAGCACCCACCTAGCAACCCTCCTA
AGCTTCCCCTCCCGCCGCTCGACCCTCCCAGAGCTACACGCCAAAACAAGCAACGAGATAATCTCCCTCGCGACC
ACAATCGCAGCCTTCGAACCCGTGCACCTCTACGCCCGATCTGAAGACATCCCACAAGCCCAAGCCCTCCTCGAC
AAACAACCCCAGCACCGGTCCAACATAATCCTCATCGCAGCGCCAACAAACCACTGCTGGATCCGCGACACAGGC
CCCGTCTACGTCCACAGCGCCGACCCAGCAGACAAAACCCGCTACGCAATCGACTTCCGCTTCTGCGAATGGGGC
CACAAAACCACAGAATACATCTACGGCGCCAACGCCTCGCCCGCAGCAGCAGAGGCGCTCGAAACATCCCCGCAA
TACGCCGAGTGGCCGGTAATGGACGCGCAAGCCATGAGCGAGAACACGGCGTTCGCGGGCGTCGTGCTGGATCTC
GAGAATGCGGGCGCGGACACGGTGGCGGATGTTGTCGTGCGGGTGGAGACGGATATCCGGCTCGAGGGCGGGGGT
ATTGAGGTCGACGGCGAGGGGACGTTCATGGCGACGGAGAGTAGTATTATTGGCGATGCGCGCAATCCTGGACTC
GGGAAGGCGGAGATCGAGGCGGAGCTTCGTCGGTTGCTAGGTGTCAGTACGTTCATTTGGTTCCCCGGGAGGGTG
GGGCTCGATGTTACGGATTTGCATGTTGATGCTGAGGCGAGGTTTGTGAGACCTGGGGTTGTGGTTGTTTGTCGT
CCGCATGAGAAGGCGGAGAAGGTGCGTTGGGAGGTCTATTCGGAGATTCGGGCCGTCTTGGAGAGATCTACTGAT
GCGCGTGGTCGGCGCTTTGAGGTTCATGATGTTGTTGAGCCGGATCCGAGCTTCGTTCAGGGGGGTCTTGCTGGG
GAGGAGGAGGCGTCGGCGGCTTCGTATGTGAACTTTTACTTTGTTAATGGTGGACTGGTTATCCCGGCGTTTGGG
GATCCTGAGGCTGATGAGAAGGCCTTTGAGTTGATGAAGAGCCTGGTTCCCGGGAGGGAGGTTCGTCAGGTTGAG
GTCAATGCCTTGCCTAGGACTGGAGGTGTGCTGCATTGTGTTACACAGCAGGTGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail