Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7057.t1
Gene name
Locationscaffold_20:351683..353363
Strand-
Gene length (bp)1680
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00569 ZZ Zinc finger, ZZ type 2.9E-10 17 61
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 6.1E-10 82 124
PF04433 SWIRM SWIRM domain 5.1E-08 445 515

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 69.20 42.00 96.40
5d_25C Five days - 25 degrees Celsius 71.38 43.66 99.11
7d_25C Seven days - 25 degrees Celsius 70.60 43.19 98.00
10d_25C Ten days - 25 degrees Celsius 87.55 53.31 121.79
7d_15C Seven days - 15 degrees Celsius 69.75 42.29 97.22
7d_30C Seven days - 30 degrees Celsius 73.24 44.44 102.03

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.927866 no
3d_25C 7d_25C 0.953631 no
3d_25C 7d_15C 0.984350 no
3d_25C 7d_30C 0.862042 no
3d_25C 10d_25C 0.328074 no
5d_25C 7d_25C 0.973209 no
5d_25C 7d_15C 0.946649 no
5d_25C 7d_30C 0.939086 no
5d_25C 10d_25C 0.400368 no
7d_25C 7d_15C 0.974828 no
7d_25C 7d_30C 0.912581 no
7d_25C 10d_25C 0.369450 no
7d_15C 7d_30C 0.880758 no
7d_15C 10d_25C 0.354964 no
7d_30C 10d_25C 0.493502 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7057.t1
MGVIRKKTASRGTEAGTKFHCDVCSIDVTSTVRISCSHPACPEYDLCVPCFSAGKNSKNHDPATHPFQVIEQNSV
PIFQADWGADEELLLLEGAEIYGLGSWADIADHIGGYRSKDEVRDHYYNTYVKSVNFPLAARADPDDRALQDSIS
KEDFQTRKKRRIEERKDAAKTAPPTTPKQKPTASVPACHEVQGYMPGRLEFETEFLNDAEEAVQHMTFEPGAGFN
ENGEPDAETELKMTVVDIYNSRLTARTERKKILFEHNLLDYRKNTALDKKRSKEERDLLNKAKPLARMMNCKDFE
DVNKGLEYEHNLRLAISQLQEWRQMGIGDLKAGEKYEQDKQQRVQRLLPQGSFDRFASTRPKQSQLTETPAAAIQ
LTTPELPLRLQKAANPHAPADSTEETLNDFDRAFAVDGDAPPPQPAKTKYVVPPLSGMPSWKLDNETAADLHLLT
KEEAEVCNVLRLMPKPYLVIKETLLKEAMKQGGNLKKKDARMICKIEGTKTSRIYDFMVHSGWINKA*
Coding >Pro_DTO377G3_2|g7057.t1
ATGGGTGTGATACGCAAGAAGACCGCCTCGCGCGGCACCGAGGCCGGCACCAAGTTCCACTGCGATGTGTGCTCC
ATTGATGTTACGTCAACAGTTCGCATCTCGTGCTCGCATCCCGCCTGCCCCGAATATGACCTCTGTGTTCCCTGT
TTCTCAGCCGGAAAGAATTCCAAGAACCATGACCCCGCCACACATCCATTCCAAGTGATCGAACAGAACTCAGTC
CCCATATTCCAGGCAGATTGGGGTGCCGACGAAGAACTGTTATTGCTGGAAGGCGCCGAAATCTATGGGCTGGGT
TCCTGGGCAGACATCGCAGACCACATTGGCGGCTACCGGAGCAAGGATGAAGTGCGAGACCACTACTACAATACA
TATGTGAAGAGCGTCAACTTTCCGCTCGCAGCCCGTGCCGATCCAGACGATAGGGCCTTGCAGGATTCGATCTCC
AAAGAGGATTTTCAAACACGCAAGAAGCGTCGCATCGAAGAGCGCAAAGATGCAGCCAAGACAGCACCTCCAACC
ACACCAAAGCAGAAGCCGACTGCCAGTGTACCGGCGTGTCACGAAGTGCAGGGCTACATGCCGGGACGATTGGAG
TTCGAGACCGAGTTCTTGAACGATGCCGAAGAAGCGGTGCAGCACATGACTTTTGAGCCTGGGGCTGGATTCAAT
GAAAATGGCGAGCCAGACGCAGAGACCGAGCTCAAGATGACCGTGGTTGACATCTACAACTCCCGCCTGACAGCG
CGAACAGAGCGCAAGAAAATCCTCTTCGAGCACAACCTCCTCGACTACCGAAAGAACACCGCCTTAGATAAGAAA
CGGTCCAAGGAAGAGCGAGATTTGTTGAACAAAGCAAAGCCACTAGCACGGATGATGAACTGCAAGGACTTTGAA
GACGTCAACAAGGGCTTAGAGTACGAGCACAACCTCCGCCTAGCCATCTCCCAGCTTCAAGAATGGCGCCAGATG
GGCATCGGTGACCTAAAGGCAGGCGAGAAGTACGAGCAGGATAAGCAACAGCGCGTTCAACGACTGCTTCCTCAA
GGATCATTTGACCGTTTTGCCAGCACCCGCCCTAAGCAGTCACAGCTGACAGAGACACCCGCGGCAGCGATTCAG
CTTACAACACCTGAACTGCCTCTGCGACTGCAAAAAGCGGCCAATCCACACGCACCAGCGGACTCCACCGAAGAA
ACACTGAACGATTTCGATCGCGCCTTCGCTGTCGATGGGGATGCGCCTCCCCCGCAGCCGGCAAAGACGAAATAT
GTGGTGCCTCCATTAAGCGGGATGCCGTCGTGGAAGCTGGACAATGAGACTGCTGCCGATCTGCATCTCCTGACC
AAGGAAGAGGCAGAAGTATGCAATGTTCTACGCCTGATGCCTAAGCCATATCTGGTCATCAAGGAGACACTGTTG
AAGGAAGCAATGAAGCAGGGCGGCAACCTGAAGAAGAAAGATGCACGGATGATTTGCAAGATTGAGGGCACCAAA
ACTAGCCGCATTTATGATTTCATGGTACACAGTGGTTGGATCAACAAGGCGTAG
Transcript >Pro_DTO377G3_2|g7057.t1
ATGGGTGTGATACGCAAGAAGACCGCCTCGCGCGGCACCGAGGCCGGCACCAAGTTCCACTGCGATGTGTGCTCC
ATTGATGTTACGTCAACAGTTCGCATCTCGTGCTCGCATCCCGCCTGCCCCGAATATGACCTCTGTGTTCCCTGT
TTCTCAGCCGGAAAGAATTCCAAGAACCATGACCCCGCCACACATCCATTCCAAGTGATCGAACAGAACTCAGTC
CCCATATTCCAGGCAGATTGGGGTGCCGACGAAGAACTGTTATTGCTGGAAGGCGCCGAAATCTATGGGCTGGGT
TCCTGGGCAGACATCGCAGACCACATTGGCGGCTACCGGAGCAAGGATGAAGTGCGAGACCACTACTACAATACA
TATGTGAAGAGCGTCAACTTTCCGCTCGCAGCCCGTGCCGATCCAGACGATAGGGCCTTGCAGGATTCGATCTCC
AAAGAGGATTTTCAAACACGCAAGAAGCGTCGCATCGAAGAGCGCAAAGATGCAGCCAAGACAGCACCTCCAACC
ACACCAAAGCAGAAGCCGACTGCCAGTGTACCGGCGTGTCACGAAGTGCAGGGCTACATGCCGGGACGATTGGAG
TTCGAGACCGAGTTCTTGAACGATGCCGAAGAAGCGGTGCAGCACATGACTTTTGAGCCTGGGGCTGGATTCAAT
GAAAATGGCGAGCCAGACGCAGAGACCGAGCTCAAGATGACCGTGGTTGACATCTACAACTCCCGCCTGACAGCG
CGAACAGAGCGCAAGAAAATCCTCTTCGAGCACAACCTCCTCGACTACCGAAAGAACACCGCCTTAGATAAGAAA
CGGTCCAAGGAAGAGCGAGATTTGTTGAACAAAGCAAAGCCACTAGCACGGATGATGAACTGCAAGGACTTTGAA
GACGTCAACAAGGGCTTAGAGTACGAGCACAACCTCCGCCTAGCCATCTCCCAGCTTCAAGAATGGCGCCAGATG
GGCATCGGTGACCTAAAGGCAGGCGAGAAGTACGAGCAGGATAAGCAACAGCGCGTTCAACGACTGCTTCCTCAA
GGATCATTTGACCGTTTTGCCAGCACCCGCCCTAAGCAGTCACAGCTGACAGAGACACCCGCGGCAGCGATTCAG
CTTACAACACCTGAACTGCCTCTGCGACTGCAAAAAGCGGCCAATCCACACGCACCAGCGGACTCCACCGAAGAA
ACACTGAACGATTTCGATCGCGCCTTCGCTGTCGATGGGGATGCGCCTCCCCCGCAGCCGGCAAAGACGAAATAT
GTGGTGCCTCCATTAAGCGGGATGCCGTCGTGGAAGCTGGACAATGAGACTGCTGCCGATCTGCATCTCCTGACC
AAGGAAGAGGCAGAAGTATGCAATGTTCTACGCCTGATGCCTAAGCCATATCTGGTCATCAAGGAGACACTGTTG
AAGGAAGCAATGAAGCAGGGCGGCAACCTGAAGAAGAAAGATGCACGGATGATTTGCAAGATTGAGGGCACCAAA
ACTAGCCGCATTTATGATTTCATGGTACACAGTGGTTGGATCAACAAGGCGTAG
Gene >Pro_DTO377G3_2|g7057.t1
ATGGGTGTGATACGCAAGAAGACCGCCTCGCGCGGCACCGAGGCCGGCACCAAGTTCCACTGCGATGTGTGCTCC
ATTGATGTTACGTCAACAGTAAGTCTTCATGTCTGTCATGGCCATTTAAAGGTCTGTTGTTTTGTTCAGAGACTA
ATGCGATTCCATCGCATAGGTTCGCATCTCGTGCTCGCATCCCGCCTGCCCCGAATATGACCTCTGTGTTCCCTG
TTTCTCAGCCGGAAAGAATTCCAAGAACCATGACCCCGCCACACATCCATTCCAAGTGATCGAACAGAACTCAGT
CCCCATATTCCAGGCAGATTGGGGTGCCGACGAAGAACTGTTATTGCTGGAAGGCGCCGAAATCTATGGGCTGGG
TTCCTGGGCAGACATCGCAGACCACATTGGCGGCTACCGGAGCAAGGATGAAGTGCGAGACCACTACTACAATAC
ATATGTGAAGAGCGTCAACTTTCCGCTCGCAGCCCGTGCCGATCCAGACGATAGGGCCTTGCAGGATTCGATCTC
CAAAGAGGATTTTCAAACACGCAAGAAGCGTCGCATCGAAGAGCGCAAAGATGCAGCCAAGACAGCACCTCCAAC
CACACCAAAGCAGAAGCCGACTGCCAGTGTACCGGCGTGTCACGAAGTGCAGGGCTACATGCCGGGACGATTGGA
GTTCGAGACCGAGTTCTTGAACGATGCCGAAGAAGCGGTGCAGCACATGACTTTTGAGCCTGGGGCTGGATTCAA
TGAAAATGGCGAGCCAGACGCAGAGACCGAGCTCAAGATGACCGTGGTTGACATCTACAACTCCCGCCTGACAGC
GCGAACAGAGCGCAAGAAAATCCTCTTCGAGCACAACCTCCTCGACTACCGAAAGAACACCGCCTTAGATAAGAA
ACGGTCCAAGGAAGAGCGAGATTTGTTGAACAAAGCAAAGCCACTAGCACGGATGATGAACTGCAAGGACTTTGA
AGACGTCAACAAGGGCTTAGAGTACGAGCACAACCTCCGCCTAGCCATCTCCCAGCTTCAAGAATGGCGCCAGAT
GGGCATCGGTGACCTAAAGGCAGGCGAGAAGTACGAGCAGGATAAGCAACAGCGCGTTCAACGACTGCTTCCTCA
AGGATCATTTGACCGTTTTGCCAGCACCCGCCCTAAGCAGTCACAGCTGACAGAGACACCCGCGGCAGCGATTCA
GCTTACAACACCTGAACTGCCTCTGCGACTGCAAAAAGCGGCCAATCCACACGCACCAGCGGACTCCACCGAAGA
AACACTGAACGATTTCGATCGCGCCTTCGCTGTCGATGGGGATGCGCCTCCCCCGCAGCCGGCAAAGACGAAATA
TGTGGTGCCTCCATTAAGCGGGATGCCGTCGTGGAAGCTGGACAATGAGACTGCTGCCGATCTGCATCTCCTGAC
CAAGGAAGAGGCAGAAGTATGCAATGTTCTACGCCTGATGCCTAAGCCATATCTGGTCATCAAGGAGACACTGTT
GAAGGAAGCAATGAAGCAGGGCGGCAACCTGAAGAAGAAAGATGCACGGATGATTTGCAAGGTATGTTTCTCACT
CGACTCTTGCATGCGGACTCTTACTGATTCTGTTAGATTGAGGGCACCAAAACTAGCCGCATTTATGATTTCATG
GTACACAGTGGTTGGATCAACAAGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail