Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7050.t1
Gene name
Locationscaffold_20:333420..335171
Strand+
Gene length (bp)1751
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04139 Rad9 Rad9 6.7E-51 19 284

GO

GO Term Description Terminal node
GO:0000077 DNA damage checkpoint signaling Yes
GO:0030896 checkpoint clamp complex Yes
GO:0065007 biological regulation No
GO:0140513 nuclear protein-containing complex No
GO:0051726 regulation of cell cycle No
GO:0033554 cellular response to stress No
GO:1901987 regulation of cell cycle phase transition No
GO:0000075 cell cycle checkpoint signaling No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0050789 regulation of biological process No
GO:0031570 DNA integrity checkpoint signaling No
GO:0032991 protein-containing complex No
GO:1901988 negative regulation of cell cycle phase transition No
GO:0048519 negative regulation of biological process No
GO:0010948 negative regulation of cell cycle process No
GO:0035556 intracellular signal transduction No
GO:0045786 negative regulation of cell cycle No
GO:0006950 response to stress No
GO:0006974 cellular response to DNA damage stimulus No
GO:0007165 signal transduction No
GO:0050896 response to stimulus No
GO:0048523 negative regulation of cellular process No
GO:0042770 signal transduction in response to DNA damage No
GO:0051716 cellular response to stimulus No
GO:0050794 regulation of cellular process No
GO:0010564 regulation of cell cycle process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 45.21 26.35 64.06
5d_25C Five days - 25 degrees Celsius 50.65 29.83 71.47
7d_25C Seven days - 25 degrees Celsius 52.87 31.11 74.63
10d_25C Ten days - 25 degrees Celsius 50.70 29.87 71.53
7d_15C Seven days - 15 degrees Celsius 67.56 40.03 95.08
7d_30C Seven days - 30 degrees Celsius 44.91 26.08 63.74

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.705470 no
3d_25C 7d_25C 0.577703 no
3d_25C 7d_15C 0.072335 no
3d_25C 7d_30C 0.986640 no
3d_25C 10d_25C 0.703545 no
5d_25C 7d_25C 0.903475 no
5d_25C 7d_15C 0.224791 no
5d_25C 7d_30C 0.686874 no
5d_25C 10d_25C 0.997772 no
7d_25C 7d_15C 0.324813 no
7d_25C 7d_30C 0.558907 no
7d_25C 10d_25C 0.903207 no
7d_15C 7d_30C 0.068107 no
7d_15C 10d_25C 0.229033 no
7d_30C 10d_25C 0.686048 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7050.t1
MTSLSLSLGPLALVRLHDALICLSKFSETVAIEAEPDILRLSALNSTKTGFASFAFEKGVFFEAYSFNSSSNGRS
GSVSLDRFFCQIYNKALLSIFRGKTDRNKDTAVERCDMELHEDLQQAECRLTVKMICGLGVIKSYKLTYEPAAIQ
HAIFDKSRATSMWTADPRFLKQLIEHFSLSAEQLDMYSDSGRAVFTSFTTKITEGKEVLKHPVHTSVAADTRDFQ
EYLVEENMHVAINLKDFKAVVAHAETANASVTARYTRPCKPLQLEYGFEGINAEFTVMTRGQADSEDAPTSTRAS
IPRQTPVPIPISASRSRDTRPSVTTNTQMPPPPPRTRSIRPLNGSSTQENLSQRASADRPAASGLSMEFDSLFVP
ADDDRQWDEMKDEEEPQDILGWDASGTQDAFGATIRDAEPALLREDEPNDDTGLPPTQRFSQVRQYGFFD*
Coding >Pro_DTO377G3_2|g7050.t1
ATGACGTCGCTCTCATTGTCGTTAGGCCCGTTAGCCTTGGTCCGGCTCCACGACGCCTTAATATGCCTGTCCAAA
TTCAGCGAAACAGTCGCCATCGAAGCAGAGCCTGATATCCTCCGCCTCAGTGCGCTCAATTCTACCAAGACGGGG
TTTGCCTCCTTCGCGTTCGAGAAGGGGGTATTCTTTGAGGCGTATTCTTTCAATTCCAGCAGTAATGGCAGAAGT
GGCAGTGTTTCGCTGGACCGATTCTTCTGCCAGATCTATAACAAAGCACTTCTCTCCATATTTCGTGGGAAAACT
GACAGAAACAAGGACACAGCCGTTGAACGCTGTGACATGGAATTGCATGAAGATCTACAGCAAGCCGAGTGTAGA
CTGACAGTGAAAATGATCTGTGGACTAGGCGTGATCAAGTCATATAAATTGACTTACGAACCAGCGGCAATTCAG
CACGCCATCTTCGACAAATCCAGAGCTACCAGCATGTGGACAGCTGATCCACGGTTCCTCAAGCAGCTCATTGAG
CACTTCAGCTTATCTGCCGAGCAGCTGGACATGTACTCCGATTCCGGCAGAGCGGTGTTCACGAGTTTTACAACA
AAGATCACCGAAGGCAAGGAAGTACTAAAACACCCTGTCCACACATCCGTAGCAGCAGACACGCGCGACTTCCAA
GAGTACTTGGTCGAAGAGAACATGCACGTCGCGATCAACCTGAAAGACTTCAAAGCCGTAGTTGCGCACGCCGAA
ACGGCAAACGCCAGCGTAACAGCACGGTACACCCGACCCTGCAAGCCTCTGCAGCTGGAGTACGGATTTGAAGGC
ATCAACGCAGAATTCACAGTCATGACCCGCGGCCAGGCAGATAGCGAAGACGCCCCGACGTCAACACGAGCGTCA
ATCCCACGGCAAACGCCCGTGCCTATCCCAATCTCAGCGAGCAGGTCGCGTGATACTCGCCCATCGGTGACGACA
AATACGCAGATGCCCCCACCGCCACCGCGAACCAGATCCATCCGTCCTCTCAATGGGTCGTCTACGCAGGAGAAT
CTGAGCCAGAGGGCTAGCGCAGATCGGCCGGCGGCGTCTGGGCTTTCGATGGAATTCGATAGCCTTTTCGTGCCT
GCTGATGATGACCGGCAGTGGGATGAGATGAAGGACGAAGAGGAGCCGCAGGATATTCTTGGATGGGATGCGTCG
GGAACACAGGACGCATTCGGGGCAACTATTCGCGATGCGGAGCCTGCCTTGTTGAGAGAGGATGAGCCAAACGAT
GATACGGGTCTCCCGCCAACACAACGTTTTTCTCAGGTTCGCCAATATGGTTTCTTCGACTGA
Transcript >Pro_DTO377G3_2|g7050.t1
ATGACGTCGCTCTCATTGTCGTTAGGCCCGTTAGCCTTGGTCCGGCTCCACGACGCCTTAATATGCCTGTCCAAA
TTCAGCGAAACAGTCGCCATCGAAGCAGAGCCTGATATCCTCCGCCTCAGTGCGCTCAATTCTACCAAGACGGGG
TTTGCCTCCTTCGCGTTCGAGAAGGGGGTATTCTTTGAGGCGTATTCTTTCAATTCCAGCAGTAATGGCAGAAGT
GGCAGTGTTTCGCTGGACCGATTCTTCTGCCAGATCTATAACAAAGCACTTCTCTCCATATTTCGTGGGAAAACT
GACAGAAACAAGGACACAGCCGTTGAACGCTGTGACATGGAATTGCATGAAGATCTACAGCAAGCCGAGTGTAGA
CTGACAGTGAAAATGATCTGTGGACTAGGCGTGATCAAGTCATATAAATTGACTTACGAACCAGCGGCAATTCAG
CACGCCATCTTCGACAAATCCAGAGCTACCAGCATGTGGACAGCTGATCCACGGTTCCTCAAGCAGCTCATTGAG
CACTTCAGCTTATCTGCCGAGCAGCTGGACATGTACTCCGATTCCGGCAGAGCGGTGTTCACGAGTTTTACAACA
AAGATCACCGAAGGCAAGGAAGTACTAAAACACCCTGTCCACACATCCGTAGCAGCAGACACGCGCGACTTCCAA
GAGTACTTGGTCGAAGAGAACATGCACGTCGCGATCAACCTGAAAGACTTCAAAGCCGTAGTTGCGCACGCCGAA
ACGGCAAACGCCAGCGTAACAGCACGGTACACCCGACCCTGCAAGCCTCTGCAGCTGGAGTACGGATTTGAAGGC
ATCAACGCAGAATTCACAGTCATGACCCGCGGCCAGGCAGATAGCGAAGACGCCCCGACGTCAACACGAGCGTCA
ATCCCACGGCAAACGCCCGTGCCTATCCCAATCTCAGCGAGCAGGTCGCGTGATACTCGCCCATCGGTGACGACA
AATACGCAGATGCCCCCACCGCCACCGCGAACCAGATCCATCCGTCCTCTCAATGGGTCGTCTACGCAGGAGAAT
CTGAGCCAGAGGGCTAGCGCAGATCGGCCGGCGGCGTCTGGGCTTTCGATGGAATTCGATAGCCTTTTCGTGCCT
GCTGATGATGACCGGCAGTGGGATGAGATGAAGGACGAAGAGGAGCCGCAGGATATTCTTGGATGGGATGCGTCG
GGAACACAGGACGCATTCGGGGCAACTATTCGCGATGCGGAGCCTGCCTTGTTGAGAGAGGATGAGCCAAACGAT
GATACGGGTCTCCCGCCAACACAACGTTTTTCTCAGGTTCGCCAATATGGTTTCTTCGACTGA
Gene >Pro_DTO377G3_2|g7050.t1
ATGACGTCGCTCTCATTGTCGTTAGGCCCGTTAGCCTTGGTCCGGCTCCACGACGCCTTAATATGCCTGTCCAAA
TTCAGCGAAACAGTCGCCATCGAAGCAGAGCCTGATATCGTAAGTTATCTTTCTTAACTTGGGGTGTTTAGTTCA
GTTCAAGGTTTAGAAGCCAGCAGATGAAATGTTCTGGCTAACCGTGCTCCAGCTCCGCCTCAGTGCGCTCAATTC
TACCAAGACGGGGTTTGCCTCCTTCGCGTTCGAGAAGGGGGTATTCTTTGAGGCGTATTCTTTCAATTCCAGCAG
TAATGGCAGAAGTGGCAGTGTTTCGCTGGACCGATTCTTCTGCCAGATCTATAACAAAGTGAGTATAGACTTTTT
TATCCTTGGAGCTGTACCATACCGCATATTTACCGTGGTTATCTTCCTTACTTTATGCTGATATAGAATACAGGC
ACTTCTCTCCATATTTCGTGGGAAAACTGACAGAAACAAGGACACAGCCGTTGAACGCTGTGACATGGAATTGCA
TGAAGATCTACAGCAAGCCGAGTGTAGACTGACAGTGAAAATGATCTGTGGACTAGGTAAGATACCCTTGCATAT
ATCCATCTTTTGGCTTCACTGCACATCTCTGACAATTTATCTAGGCGTGATCAAGTCATATAAATTGACTTACGA
ACCAGCGGCAATTCAGCACGCCATCTTCGACAAATCCAGAGCTACCAGCATGTGGACAGCTGATCCACGGTTCCT
CAAGCAGCTCATTGAGCACTTCAGCTTATCTGCCGAGCAGCTGGACATGTACTCCGATTCCGGCAGAGCGGTGTT
CACGAGTTTTACAACAAAGATCACCGAAGGCAAGGGTATGTCGAGTTCGCCTCCATCAAATCTCCAATGTCTAGT
TAACTAACAACCCAAACAGAAGTACTAAAACACCCTGTCCACACATCCGTAGCAGCAGACACGCGCGACTTCCAA
GAGTACTTGGTCGAAGAGAACATGCACGTCGCGATCAACCTGAAAGACTTCAAAGCCGTAGTTGCGCACGCCGAA
ACGGCAAACGCCAGCGTAACAGCACGGTACACCCGACCCTGCAAGCCTCTGCAGCTGGAGTACGGATTTGAAGGC
ATCAACGCAGAATTCACAGTCATGACCCGCGGCCAGGCAGATAGCGAAGACGCCCCGACGTCAACACGAGCGTCA
ATCCCACGGCAAACGCCCGTGCCTATCCCAATCTCAGCGAGCAGGTCGCGTGATACTCGCCCATCGGTGACGACA
AATACGCAGATGCCCCCACCGCCACCGCGAACCAGATCCATCCGTCCTCTCAATGGGTCGTCTACGCAGGAGAAT
CTGAGCCAGAGGGCTAGCGCAGATCGGCCGGCGGCGTCTGGGCTTTCGATGGAATTCGATAGCCTTTTCGTGCCT
GCTGATGATGACCGGCAGTGGGATGAGATGAAGGACGAAGAGGAGCCGCAGGATATTCTTGGATGGGATGCGTCG
GGAACACAGGTATGTGGTTTTCTTTCTTCCCCAGTGGGTATAGTGGGTGGCTAAACAAACGCGCAGGACGCATTC
GGGGCAACTATTCGCGATGCGGAGCCTGCCTTGTTGAGAGAGGATGAGCCAAACGATGATACGGGTCTCCCGCCA
ACACAACGTTTTTCTCAGGTATGTGAATTCTGGCTCTTGCGACACTTTGATAGGCGTATGCTGATAGTTGATAGG
TTCGCCAATATGGTTTCTTCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail