Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7045.t1
Gene name
Locationscaffold_20:317816..322449
Strand+
Gene length (bp)4633
Transcript length (bp)3090
Coding sequence length (bp)3090
Protein length (aa) 1030

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain 2.6E-25 789 1009
PF00474 SSF Sodium:solute symporter family 6.3E-16 49 454
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 6.7E-12 701 738
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 3.2E-08 699 741
PF13639 zf-RING_2 Ring finger domain 2.3E-07 700 739
PF13445 zf-RING_UBOX RING-type zinc-finger 1.8E-07 701 725
PF14634 zf-RING_5 zinc-RING finger domain 7.4E-07 701 740
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 7.4E-07 701 738

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 59 81 22
3 91 110 19
4 131 153 22
5 163 185 22
6 197 219 22
7 255 277 22
8 290 312 22
9 359 381 22
10 402 424 22
11 428 450 22
12 457 476 19
13 496 518 22
14 564 586 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7045.t1
MSDISPPLSQGVGYGVVIGVGLSFAAGMIFVTKALKSTVGEDNSNAETFIVANRRVSTGLVASAVVSSWLWSTAL
LSAVLVAYQYGVSGPFWYGAGCSPMIVCFAYLGTVCKKRVPSAHTVLEIIKMRYGTVAHLSFTFLAVVNNLFNTI
NMILGASVAITYLTGMHIMASTFLLPVGVVIYTLTGGIKATFLTDYIHTFIILILCCYLTTKALTSVEVKSIGGL
YDLVIAAQPNHLVDGNYQGSLFTMTSQQGIFFGIILLVSNFGAVIMDTGYFTKAFAASPEGVVPGYVIGGLSYFS
IPWALGTIMGMVALGLESTKAFPTYPRPMTSTEVTNGLALPYAAIAVAGKGGAVATLLMTFMAVTSTLSAQVIAV
SSIVAFDGYRTYFNKNANNQEIIFWSRVGVIIFGLVAAGLTAMFHYVGIDMGWTLYMIGVITCPGIFPLILSILW
RKQSRIAVIASAYLGLATGLAVWLGTAHHFYGAVTVSSTGQTLPCMYGTVASAVSPLLYSVLITLIAPEDFDWKS
MSNNDLAIHSEGEVTEVTKERNETGQLSESSQRRWSRYALFWAVATFFGHWVLWPLPMYGARFIFSRGFFIAWVV
LVGLFGEILGSEADNVPLDSSEDDGPLLRWKTDGRNKNGSGHLKRHGWLRGIYSLALEGRFPSDACEVIYGDSTT
PAGSSEVQDLIHFQKLRDSLCAELDCQVCYALLLDPMTTPCGHTFCRKCVARVLNHTDLCPICRRKLGIPNDLQS
EPINQPVARLVEYFFPDQISVRRETSAQDETGADYAKSLPLFVCTLSFPTMPTFLHVFEPRYRLMIQRVLASGNG
KFGMVMHNRQGRVQPGQLHDAPFMQYGTLLMIERYELLPDGRSLVVATGVSRFKIVDSGMLDGYYVAKTERVDDI
SLAEEERCESLETSTGGVNALSEGNEADPPLGSMPTQQLLLSAREYITNQRRYGAPWLHPRVMLAYGPIPTDAAR
FPWWFASILPISEEEKYPLLAATSVRERLKLSAKWARQLEARDWSTRSSLYSVL*
Coding >Pro_DTO377G3_2|g7045.t1
ATGTCCGACATATCTCCCCCGTTATCACAAGGTGTAGGGTATGGAGTCGTGATTGGTGTTGGGTTGTCATTTGCA
GCAGGAATGATATTTGTCACCAAGGCATTGAAAAGTACAGTGGGCGAAGATAATTCGAATGCTGAAACATTTATT
GTTGCCAATCGGAGAGTCAGCACGGGTTTAGTTGCCTCGGCAGTTGTATCTTCCTGGCTTTGGAGCACTGCATTG
CTGAGTGCCGTATTGGTGGCCTATCAATACGGCGTAAGTGGCCCATTTTGGTATGGTGCTGGATGCTCACCTATG
ATCGTCTGTTTTGCGTATCTCGGCACTGTCTGTAAAAAGCGTGTGCCCAGCGCGCACACTGTTCTGGAAATCATC
AAGATGCGATATGGCACTGTCGCTCACTTAAGCTTCACCTTTCTGGCTGTGGTGAATAATCTCTTTAACACCATC
AACATGATTTTAGGTGCTTCAGTCGCCATTACATATTTAACTGGGATGCACATCATGGCATCCACTTTCCTGCTG
CCAGTTGGTGTGGTCATTTATACCCTCACTGGAGGTATCAAAGCAACGTTTCTAACTGATTATATTCACACTTTC
ATTATTTTGATTCTGTGTTGTTATTTGACCACCAAAGCGTTGACCAGCGTGGAGGTCAAGTCGATTGGGGGTTTG
TATGATCTTGTCATTGCAGCTCAGCCAAATCATCTCGTGGATGGAAATTACCAAGGCTCGCTTTTTACCATGACA
TCTCAACAGGGAATTTTTTTTGGAATCATTCTTTTGGTGTCAAACTTCGGAGCTGTCATTATGGATACCGGATAC
TTCACTAAGGCATTTGCTGCGTCCCCAGAAGGTGTCGTTCCTGGATACGTGATTGGGGGTTTATCTTATTTCAGT
ATTCCTTGGGCTCTTGGAACTATTATGGGGATGGTTGCGTTGGGATTGGAGAGCACAAAGGCCTTCCCAACATAT
CCGAGACCCATGACTAGTACTGAAGTCACGAATGGACTAGCTTTGCCTTACGCAGCCATCGCGGTAGCGGGCAAA
GGTGGCGCAGTGGCTACTCTCCTGATGACTTTTATGGCTGTTACGTCTACACTGTCAGCACAGGTCATTGCTGTC
TCTTCGATTGTGGCCTTTGATGGCTACCGCACCTACTTCAACAAGAATGCAAACAATCAAGAGATAATCTTCTGG
AGTCGGGTGGGAGTGATTATATTCGGCCTTGTCGCGGCAGGCCTCACTGCAATGTTCCACTATGTTGGCATTGAC
ATGGGCTGGACCCTTTACATGATTGGAGTGATCACCTGCCCCGGGATATTTCCCCTGATACTGTCGATTCTTTGG
AGAAAGCAAAGCCGGATCGCGGTCATTGCGTCGGCGTATCTCGGTCTAGCCACGGGCCTCGCTGTCTGGCTCGGA
ACAGCGCATCATTTCTATGGTGCCGTTACAGTCTCTTCAACTGGACAGACATTGCCATGCATGTACGGCACAGTG
GCATCTGCAGTTAGCCCGTTACTATACTCCGTGTTGATTACATTGATTGCACCGGAAGACTTCGACTGGAAGTCG
ATGAGCAATAACGACCTGGCTATCCATTCTGAGGGTGAAGTTACCGAGGTTACTAAAGAGAGAAATGAAACGGGC
CAGCTTTCCGAGTCAAGCCAAAGGAGATGGTCACGATACGCGTTATTTTGGGCCGTTGCTACTTTCTTCGGCCAC
TGGGTTCTCTGGCCACTTCCGATGTATGGTGCTAGGTTTATATTCAGCAGAGGATTCTTCATCGCCTGGGTTGTG
CTGGTTGGCCTTTTTGGAGAAATACTGGGGTCGGAGGCAGACAACGTGCCTCTGGACTCGTCCGAGGATGACGGA
CCGTTACTGCGCTGGAAAACCGACGGGCGGAATAAGAACGGAAGTGGGCATTTGAAGCGACATGGGTGGTTGAGG
GGAATCTATAGCCTGGCACTGGAAGGCCGGTTCCCGTCTGATGCATGCGAAGTCATCTATGGAGATTCCACAACG
CCAGCCGGAAGCTCAGAAGTTCAGGATCTCATTCACTTCCAAAAGCTGCGAGACAGTCTCTGCGCCGAGTTAGAC
TGTCAGGTTTGCTATGCACTCCTTTTAGATCCGATGACGACGCCTTGTGGTCACACTTTTTGCCGAAAATGTGTC
GCGCGGGTCTTAAACCATACAGATCTGTGTCCCATTTGTCGCCGAAAGCTAGGCATTCCGAATGATCTACAGTCA
GAGCCCATAAACCAGCCTGTGGCACGGTTGGTCGAATACTTTTTCCCCGACCAGATCTCAGTCAGACGGGAGACC
AGCGCCCAGGATGAGACAGGCGCGGATTACGCGAAGAGCTTGCCACTTTTTGTGTGCACGCTATCTTTCCCGACA
ATGCCCACTTTTCTCCATGTCTTCGAGCCCAGATATCGACTTATGATTCAGCGGGTTCTCGCAAGTGGAAATGGA
AAGTTCGGCATGGTCATGCACAACCGGCAAGGCCGGGTACAGCCAGGTCAATTACATGACGCACCGTTTATGCAA
TACGGAACGCTATTGATGATCGAGCGATATGAGCTGCTTCCAGATGGTCGCAGTCTCGTGGTGGCTACAGGCGTA
TCGCGGTTCAAGATCGTCGACTCGGGAATGCTGGATGGCTATTATGTTGCCAAAACAGAGCGCGTAGATGACATC
TCGCTCGCAGAGGAGGAGCGATGTGAGTCGTTGGAGACCTCAACAGGCGGTGTAAATGCTCTGTCAGAAGGGAAT
GAAGCTGATCCTCCGTTAGGCTCAATGCCAACTCAACAGCTACTCCTCTCAGCAAGAGAGTATATCACCAACCAG
CGCAGATATGGGGCTCCTTGGCTGCACCCGCGCGTCATGCTAGCATATGGACCCATCCCTACAGATGCAGCCCGC
TTCCCATGGTGGTTCGCAAGCATTTTGCCCATCTCCGAAGAAGAGAAATATCCCTTACTCGCCGCCACAAGTGTT
CGAGAGAGACTGAAACTCTCAGCAAAATGGGCGAGACAACTTGAGGCTCGAGACTGGTCTACTCGCTCATCACTC
TACTCTGTCTTATGA
Transcript >Pro_DTO377G3_2|g7045.t1
ATGTCCGACATATCTCCCCCGTTATCACAAGGTGTAGGGTATGGAGTCGTGATTGGTGTTGGGTTGTCATTTGCA
GCAGGAATGATATTTGTCACCAAGGCATTGAAAAGTACAGTGGGCGAAGATAATTCGAATGCTGAAACATTTATT
GTTGCCAATCGGAGAGTCAGCACGGGTTTAGTTGCCTCGGCAGTTGTATCTTCCTGGCTTTGGAGCACTGCATTG
CTGAGTGCCGTATTGGTGGCCTATCAATACGGCGTAAGTGGCCCATTTTGGTATGGTGCTGGATGCTCACCTATG
ATCGTCTGTTTTGCGTATCTCGGCACTGTCTGTAAAAAGCGTGTGCCCAGCGCGCACACTGTTCTGGAAATCATC
AAGATGCGATATGGCACTGTCGCTCACTTAAGCTTCACCTTTCTGGCTGTGGTGAATAATCTCTTTAACACCATC
AACATGATTTTAGGTGCTTCAGTCGCCATTACATATTTAACTGGGATGCACATCATGGCATCCACTTTCCTGCTG
CCAGTTGGTGTGGTCATTTATACCCTCACTGGAGGTATCAAAGCAACGTTTCTAACTGATTATATTCACACTTTC
ATTATTTTGATTCTGTGTTGTTATTTGACCACCAAAGCGTTGACCAGCGTGGAGGTCAAGTCGATTGGGGGTTTG
TATGATCTTGTCATTGCAGCTCAGCCAAATCATCTCGTGGATGGAAATTACCAAGGCTCGCTTTTTACCATGACA
TCTCAACAGGGAATTTTTTTTGGAATCATTCTTTTGGTGTCAAACTTCGGAGCTGTCATTATGGATACCGGATAC
TTCACTAAGGCATTTGCTGCGTCCCCAGAAGGTGTCGTTCCTGGATACGTGATTGGGGGTTTATCTTATTTCAGT
ATTCCTTGGGCTCTTGGAACTATTATGGGGATGGTTGCGTTGGGATTGGAGAGCACAAAGGCCTTCCCAACATAT
CCGAGACCCATGACTAGTACTGAAGTCACGAATGGACTAGCTTTGCCTTACGCAGCCATCGCGGTAGCGGGCAAA
GGTGGCGCAGTGGCTACTCTCCTGATGACTTTTATGGCTGTTACGTCTACACTGTCAGCACAGGTCATTGCTGTC
TCTTCGATTGTGGCCTTTGATGGCTACCGCACCTACTTCAACAAGAATGCAAACAATCAAGAGATAATCTTCTGG
AGTCGGGTGGGAGTGATTATATTCGGCCTTGTCGCGGCAGGCCTCACTGCAATGTTCCACTATGTTGGCATTGAC
ATGGGCTGGACCCTTTACATGATTGGAGTGATCACCTGCCCCGGGATATTTCCCCTGATACTGTCGATTCTTTGG
AGAAAGCAAAGCCGGATCGCGGTCATTGCGTCGGCGTATCTCGGTCTAGCCACGGGCCTCGCTGTCTGGCTCGGA
ACAGCGCATCATTTCTATGGTGCCGTTACAGTCTCTTCAACTGGACAGACATTGCCATGCATGTACGGCACAGTG
GCATCTGCAGTTAGCCCGTTACTATACTCCGTGTTGATTACATTGATTGCACCGGAAGACTTCGACTGGAAGTCG
ATGAGCAATAACGACCTGGCTATCCATTCTGAGGGTGAAGTTACCGAGGTTACTAAAGAGAGAAATGAAACGGGC
CAGCTTTCCGAGTCAAGCCAAAGGAGATGGTCACGATACGCGTTATTTTGGGCCGTTGCTACTTTCTTCGGCCAC
TGGGTTCTCTGGCCACTTCCGATGTATGGTGCTAGGTTTATATTCAGCAGAGGATTCTTCATCGCCTGGGTTGTG
CTGGTTGGCCTTTTTGGAGAAATACTGGGGTCGGAGGCAGACAACGTGCCTCTGGACTCGTCCGAGGATGACGGA
CCGTTACTGCGCTGGAAAACCGACGGGCGGAATAAGAACGGAAGTGGGCATTTGAAGCGACATGGGTGGTTGAGG
GGAATCTATAGCCTGGCACTGGAAGGCCGGTTCCCGTCTGATGCATGCGAAGTCATCTATGGAGATTCCACAACG
CCAGCCGGAAGCTCAGAAGTTCAGGATCTCATTCACTTCCAAAAGCTGCGAGACAGTCTCTGCGCCGAGTTAGAC
TGTCAGGTTTGCTATGCACTCCTTTTAGATCCGATGACGACGCCTTGTGGTCACACTTTTTGCCGAAAATGTGTC
GCGCGGGTCTTAAACCATACAGATCTGTGTCCCATTTGTCGCCGAAAGCTAGGCATTCCGAATGATCTACAGTCA
GAGCCCATAAACCAGCCTGTGGCACGGTTGGTCGAATACTTTTTCCCCGACCAGATCTCAGTCAGACGGGAGACC
AGCGCCCAGGATGAGACAGGCGCGGATTACGCGAAGAGCTTGCCACTTTTTGTGTGCACGCTATCTTTCCCGACA
ATGCCCACTTTTCTCCATGTCTTCGAGCCCAGATATCGACTTATGATTCAGCGGGTTCTCGCAAGTGGAAATGGA
AAGTTCGGCATGGTCATGCACAACCGGCAAGGCCGGGTACAGCCAGGTCAATTACATGACGCACCGTTTATGCAA
TACGGAACGCTATTGATGATCGAGCGATATGAGCTGCTTCCAGATGGTCGCAGTCTCGTGGTGGCTACAGGCGTA
TCGCGGTTCAAGATCGTCGACTCGGGAATGCTGGATGGCTATTATGTTGCCAAAACAGAGCGCGTAGATGACATC
TCGCTCGCAGAGGAGGAGCGATGTGAGTCGTTGGAGACCTCAACAGGCGGTGTAAATGCTCTGTCAGAAGGGAAT
GAAGCTGATCCTCCGTTAGGCTCAATGCCAACTCAACAGCTACTCCTCTCAGCAAGAGAGTATATCACCAACCAG
CGCAGATATGGGGCTCCTTGGCTGCACCCGCGCGTCATGCTAGCATATGGACCCATCCCTACAGATGCAGCCCGC
TTCCCATGGTGGTTCGCAAGCATTTTGCCCATCTCCGAAGAAGAGAAATATCCCTTACTCGCCGCCACAAGTGTT
CGAGAGAGACTGAAACTCTCAGCAAAATGGGCGAGACAACTTGAGGCTCGAGACTGGTCTACTCGCTCATCACTC
TACTCTGTCTTATGA
Gene >Pro_DTO377G3_2|g7045.t1
ATGTCCGACATATCTCCCCCGTTATCACAAGGTGTAGGGTATGGAGTCGTGATTGGTGTTGGGTTGTCATTTGCA
GCAGGTAGGACGTAAATACACAACTCTTCTTATGACTATGCTAAGAATAATGAAGGAATGATATTTGTCACCAAG
GCATTGAAAAGTACAGTGGGCGAAGATAATTCGAATGCTGAAACGTATGTTTTTCCCCAAGCTTCTCATCTGACT
CCTTTTTAATCCCAACTAGATTTATTGTTGCCAATCGGAGAGTCAGCACGGGTTTAGTTGCCTCGGCAGTTGTAT
CTGTATGTGAACAAATGCTTAACAATATTCAGTGCTAACCTACAATAGTCCTGGCTTTGGAGCACTGCATTGCTG
AGTGCCGTATTGGTGGCCTATCAATACGGCGTAAGTGGCCCATTTTGGTATGGTGCTGGATGCTCACCTATGATC
GTCTGTTTTGCGTATCTCGGCACTGTCTGTAAAAAGCGTGTGCCCAGCGCGCACACTGTTCTGGAAATCATCAAG
ATGCGATATGGTGAGGACTTTACGTGTCTGTCAGTGAAACATGAAAACTAACAATTTCAAGGCACTGTCGCTCAC
TTAAGCTTCACCTTTCTGGCTGTGGTGAATAATCTCTTTAACACCATCAACATGATTTTAGGTGCTTCAGTCGCC
ATTACATATTTGTAAGTCCGGTAACCGCGCTCGAAAACACTTGTGGTCAATCGGCTTACCATGAAAGAACTGGGA
TGCACATCATGGCATCCACTTTCCTGCTGCCAGTTGGTGTGGTCATTTATACCCTCACTGGAGGTATCAAAGCAA
CGTATGTCAGATTATTTTTCAAAATATGTCCACAGCACTAATAGGGTTTGCAGGTTTCTAACTGATTATATTCAC
ACTTTCATTATTTTGATTCTGTGTTGTTATTTGACCACCAAAGCGTTGACCAGCGTGGAGGTCAAGTCGATTGGG
GGTTTGTATGATCTTGTCATTGCAGCTCAGCCAAATCATCTCGTGGATGGAAATTACCAAGGCTCGCTTTTTACC
ATGACATCTCAACAGGGAATTTTTTTTGGAATCATTCTTTTGGTGTCAAACTTCGGAGCTGTCATTGTAAGTGCC
TCCCCGAATTACTGACGGCTTGGTGCTAATTGGGAATAGATGGATACCGGATACTTCACTAAGGCATTTGCTGCG
TCCCCAGAAGGTGTCGTTCCTGGATACGTGATTGGGGGTTTATCTTATTTCAGTATTCCTTGGGCTCTTGGAACT
ATTATGGGGATGGTTGCGTTGGGATTGGAGAGCACAAAGGCCTTCCCAACATATCCGAGAGTAAGTCCAGGCCAT
CGATTCTCGATATTTGATCTTGAAGCTAAGATATTTCGAGCCCATGACTAGTACTGAAGTCACGAATGGACTAGC
TTTGCCTTACGCAGCCATCGCGGTAGCGGGCAAAGGTGGCGCAGTGGCTACTCTCCTGATGACTTTTATGGCTGT
TACGTCTACACTGTCAGCACAGGTCATTGCTGTCTCTTCGATTGTGGCCTTTGATGGCTACCGCACCTACTTCAA
CAAGAATGCAAACAATCAAGAGATAATCTTCTGGAGTCGGGTGGGAGTGATTATATTCGGCCTTGTCGCGGCAGG
CCTCACTGCAATGTTCCACTATGTTGGCATTGACATGGGCTGGACCCTTTACATGATTGGTAAGCTCAGGTACTT
ATATCAAGGATATACTCGATGTTTCTAACATAACTCGAAGGAGTGATCACCTGCCCCGGGATATTTCCCCTGATA
CTGTCGATTCTTTGGAGAAAGCAAAGCCGGATCGCGGTCATTGCGTCGGCGTATCTCGGTCTAGCCACGGGCCTC
GCTGTCTGGCTCGGAACAGCGCATCATTTCTATGGTGCCGTTACAGTCTCTTCAACTGGACAGACATTGCCATGC
ATGTACGGCACAGTGGCATCTGCAGTTAGCCCGTTACTATACTCCGTGTTGATTACATTGATTGCACCGGAAGAC
TTCGACTGGAAGTCGATGAGCAATAACGACCTGGCTATCCATTCTGAGGGTGAAGTTACCGAGGTTACTAAAGAG
AGAAATGAAACGGGCCAGCTTTCCGAGTCAAGCCAAAGGAGATGGTCACGATACGCGTTATTTTGGGCCGTTGCT
ACTTTCTTCGGCCACTGGGTTCTCTGGCCACTTCCGATGTATGGTGCTAGGTTTATATTCAGCAGAGGAGTAAGT
GCACTATATTTTCTCAAGGGTGGACAATGTCACTGACAAGATTTAGTTCTTCATCGCCTGGGTTGTGGTTGCTGA
AATTTGGCTCTGGATCACTTTGCTGACGGTTGGATTATATCCTTTGTGGGATGGACGCCGTCGGATTCTTTTCAT
CGCGCGGAGACTTGTTGGGCGTTTGGAAAATGCATAATTATTTGGTTGCCGATTGAGTGCTCACTGCTTAGCAGC
ATCATCAGTTTTATTCCGCATAATTAGTATAAGAATAAGTCGGATGCATTTACAGCCTATATCATTGAGAATGAC
ATCCATGGATGGTTGCAGAGCGAAGCGACTGATGATCACATGATGGCCCATTAGAACGCTATTATTTCAGCCCTG
GGAGAAACTTGGCCACGTGACACGTACGTAAGACCTTTTGATTTATACTTGCTTTGCTTCGTTTCGTTACGCAAT
TAATATTATTTCTTTGTATAACCACTACTATAAACGATGTACTGCGACACCGGACCTCGGGATGGTCACTGATCC
GATTATCTAAAGTTGACCCACACCTGAGCACCTGCAGATAGCGGATCCCCCACCCCCCGAGCTTCATCATTTATC
CTTCTACGTTTCCCTCTTATTCACTGCATTTGTACCCGTGGACTGCAGTGTAATGGAAGATGCAGCCGAGTCCCT
GAGCCTGACACAAATGACCGACGCTGAACCTATCCCGACCGTAATGGAGAGCCCGGAGGACTCAAGCTCAGATGT
TTCAAGCTCGGAAGAACATACACCTAGCGATACGGCAGATCTACCTCATATCGTGATCCAATTGATCCAGTGCCA
ACATTGCTCCCGCCCTTTCCGAACTCCGCTCCGCCTACCATGCGGGAATTCGATCTGTCGGGAATGTTTGCCCGC
CCTTCGGCCCCGGACAGGTATTACGTACCCCGTGACTGAGGGGAGGAATCAGGAATTCACATGCCTTTGGAAAGG
AAATAAGACGTGTGGTGGGGGCCATTGTGTTGCAGATTGTGGCGCTGATGTGCTGCTTGGGAAGCTGGTTGGCCT
TTTTGGAGAAATACTGGGGTCGGAGGCAGACAACGTGCCTCTGGACTCGTCCGAGGATGACGGACCGTTACTGCG
CTGGAAAACCGACGGGCGGAATAAGAACGGAAGTGGGCATTTGAAGCGACATGGGTGGTTGAGGGGAATCTATAG
CCTGGCACTGGAAGGCCGGTTCCCGTCTGATGCATGCGAAGTCATCTATGGAGATTCCACAACGCCAGCCGGAAG
CTCAGAAGTTCAGGATCTCATTCACTTCCAAAAGCTGCGAGACAGTCTCTGCGCCGAGTTAGACTGTCAGGTTTG
CTATGCACTCCTTTTAGATCCGATGACGACGCCTTGTGGTCACACTTTTTGCCGAAAATGTGTCGCGCGGGTCTT
AAACCATACAGATCTGTGTCCCATTTGTCGCCGAAAGCTAGGCATTCCGAATGATCTACAGTCAGAGCCCATAAA
CCAGCCTGTGGCACGGTTGGTCGAATACTTTTTCCCCGACCAGATCTCAGTCAGACGGGAGACCAGCGCCCAGGA
TGAGACAGGCGCGGATTACGCGAAGAGCTTGCCACTTTTTGTGTGCACGCTATCTTTCCCGACAATGCCCACTTT
TCTCCATGTCTTCGAGCCCAGATATCGACTTATGATTCAGCGGGTTCTCGCAAGTGGAAATGGAAAGTTCGGCAT
GGTCATGCACAACCGGCAAGGCCGGGTACAGCCAGGTCAATTACATGACGCACCGTTTATGCAATACGGAACGCT
ATTGATGATCGAGCGATATGAGCTGCTTCCAGATGGTCGCAGTCTCGTGGTGGCTACAGGCGTATCGCGGTTCAA
GATCGTCGACTCGGGAATGCTGGATGGCTATTATGTTGCCAAAACAGAGCGCGTAGATGACATCTCGCTCGCAGA
GGAGGAGCGATGTGAGTCGTTGGAGACCTCAACAGGCGGTGTAAATGCTCTGTCAGAAGGGAATGAAGCTGATCC
TCCGTTAGGCTCAATGCCAACTCAACAGCTACTCCTCTCAGCAAGAGAGTATATCACCAACCAGCGCAGATATGG
GGCTCCTTGGCTGCACCCGCGCGTCATGCTAGCATATGGACCCATCCCTACAGATGCAGCCCGCTTCCCATGGTG
GTTCGCAAGCATTTTGCCCATCTCCGAAGAAGAGAAATATCCCTTACTCGCCGCCACAAGTGTTCGAGAGAGACT
GAAACTCTCAGCAAAATGGGCGAGACAACTTGAGGCTCGAGACTGGTAGGTTCAACATCTCTTCTCCCCATTAGA
TGCTATGCTGATATTTCCGATTAGGTCTACTCGCTCATCACTCTACTCTGTCTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail