Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7040.t1
Gene name
Locationscaffold_20:302467..306588
Strand+
Gene length (bp)4121
Transcript length (bp)3954
Coding sequence length (bp)3954
Protein length (aa) 1318

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14664 RICTOR_N Rapamycin-insensitive companion of mTOR, N-term 5.8E-126 254 618
PF14663 RasGEF_N_2 Rapamycin-insensitive companion of mTOR RasGEF_N domain 1.3E-35 934 1036
PF14666 RICTOR_M Rapamycin-insensitive companion of mTOR, middle domain 1.1E-33 817 918
PF14668 RICTOR_V Rapamycin-insensitive companion of mTOR, domain 5 3.6E-25 1106 1174
PF02185 HR1 Hr1 repeat 1.3E-14 121 179

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0065007 biological regulation No
GO:0050789 regulation of biological process No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7040.t1
MASGHNSAYSASTHHRALGDGRSSLSQDGGSADGSWQDSISRIGRNRRSESGGSSNMGGRGGSLAPSLAPSIGGP
GSFSSELKSTTSRSVTPRPDDQYNRRASRSIGEADFHTTEQRQAFLRDRIAKEMKIKSGTENMLEALLAKPPKQT
KEQRLKVESELSSSNRKLIELQHELEEEILRAQAPASTPPRGNRLSSLFRASPMRSPSRNKDAVGSVNGDREEYG
DGDVESPTYVLSETLQALEIEGMSPDFYVERANSLVELFKRHPTLKYDLAWSVFGLRVQVMLLSDSKEVVAAGYR
LTRYAIADRKSLQIIRTLHTDELVILSLVKETKASIEREQALKFVRGFLDVKDGVREISRAVVRTIVAIAEHHED
RLRNISIMTVAEMLVKDPELVASAGGFAALHDALAEGTFGASESLISSFLHVVDTPRSRKFLQGSELEAVLTPFT
DSLSDTLRSGRLKSAARAISAMLKTWPGLVILARHDSQPLRSLLDSLHYNDPIARDLIMELLFDALRIKPPSWSS
SFLAGRRLTTYGRVSNLRSDLETSRASRALNDTNSNRFDLTAHFSTLILAGLVEAGLPKVLSDVIEDESDLSLRR
KATLLLTEVLKLAQHSLPQAVSAQLQVLPHLIPPAVDFETENHDLSTATIFQIDSINRTLARSGGYPSGQGRYNM
ETDLSVSLLPAEQGKDKMSPSMDETQFRNAILETHVLNTVNFNKWKWDIIHRLVEGPLTNPKRMDEAIKGSKFMK
RLIGFYRPFKYRFAMVPNTKANQRYVRTGCVLMRTLVMTPEGTKYLAENKFLRQVAECLAQLDRMSGLTSASPLF
SKDQMANTLSGGYFAMLGSLSGDVNGLLMMERWHMLNMFYHIIELQDRNDLIQTLLGNMDYSRESHLRVMLSKAL
TIGSKDIRIFATRFLRKYAVGDVTLSPQVAIDNAEWVVKLLVTQLYDPEVTVCQVAVKILEEACNQRDYLEFVVK
CRPSLDHLGEIGAPLLLRFLSTSVGYHYLDGLDYITQEMDDWFLGRNDSYVGLVEAALSRAYVEQPRRGSLVPED
LVDLQDIGLVPPHFYRELARTAEGCKLLEQSGHFNEFAWTIRDFRLDEEDNEMLLKAKGCLWAVGNIGSMELGAP
FLDAEIIQRIVQIATSAGVLTMRGTAFFVLGLISRSRHGLQVLRGLGWDSGVDQKGDSLGLCLPTDFRKLFLISF
PGFDYRSKRTPKEKLKEATTDSDPGNQRILKLIVDMGNTVLSKRAASDLHILKSKQPERFHQAHLFRKTLCILES
HHYRLPARRFALDLFDKSVMRRIVLDEDSDSESDSSTTSQSE*
Coding >Pro_DTO377G3_2|g7040.t1
ATGGCTTCCGGGCACAACTCAGCATACTCCGCGTCGACTCATCATCGTGCACTGGGTGATGGACGATCCTCGCTC
AGTCAGGATGGCGGCTCTGCCGATGGGAGCTGGCAGGACAGTATCTCACGAATCGGGAGGAACAGGCGATCCGAG
TCTGGAGGGAGCAGCAACATGGGCGGACGGGGAGGATCATTGGCGCCCTCGTTAGCTCCCTCCATCGGTGGACCA
GGGAGCTTTAGTTCGGAGCTCAAAAGCACCACTTCACGCAGTGTCACGCCTCGGCCGGACGACCAATATAACAGA
CGTGCGAGCAGATCGATCGGCGAGGCAGACTTTCACACAACCGAACAGCGACAGGCTTTCCTTCGAGACAGAATC
GCGAAGGAAATGAAGATCAAAAGCGGAACCGAGAATATGCTGGAGGCACTGCTAGCAAAACCACCAAAGCAAACG
AAAGAGCAGCGTCTCAAGGTGGAGTCGGAATTGAGCTCATCGAACCGCAAGCTGATCGAATTGCAGCATGAGTTG
GAAGAAGAAATATTACGTGCGCAGGCGCCGGCATCGACTCCTCCACGCGGCAATCGCCTTTCGAGCCTTTTCCGA
GCCAGTCCCATGCGCTCACCATCACGAAACAAGGATGCCGTCGGATCGGTAAATGGTGATAGGGAGGAATATGGT
GATGGTGACGTGGAGTCACCAACCTATGTCCTCTCAGAAACGCTGCAGGCGTTGGAGATAGAGGGGATGTCGCCT
GATTTCTATGTCGAGCGCGCCAATAGCTTGGTTGAATTATTCAAACGGCATCCCACATTGAAGTATGACCTCGCG
TGGTCTGTTTTTGGCCTACGCGTTCAAGTTATGCTTCTAAGTGACAGTAAAGAGGTGGTAGCTGCGGGTTATCGA
CTAACACGCTATGCTATCGCTGATCGCAAATCCCTACAAATCATCCGAACACTCCACACCGACGAGCTGGTGATA
TTGTCCCTGGTCAAAGAAACCAAGGCAAGCATTGAGAGGGAACAGGCCCTGAAGTTTGTGAGAGGCTTCCTGGAT
GTCAAAGACGGTGTCCGAGAGATATCACGCGCCGTTGTGCGGACCATCGTTGCTATTGCTGAACATCATGAAGAC
CGTCTTCGGAACATTTCAATCATGACCGTGGCTGAGATGTTGGTCAAAGACCCTGAACTGGTTGCTTCTGCCGGT
GGATTTGCTGCCCTGCACGACGCGCTTGCAGAGGGGACGTTCGGCGCCTCAGAGTCTCTGATATCAAGTTTTCTG
CATGTTGTGGACACCCCCCGTAGTCGGAAGTTTCTTCAAGGGTCTGAACTTGAAGCTGTTCTTACGCCTTTCACG
GATTCATTATCCGACACATTACGCAGTGGGCGATTAAAGTCGGCAGCGCGAGCCATTTCTGCGATGCTGAAGACT
TGGCCCGGACTGGTTATTCTTGCAAGACATGACTCACAACCGTTGCGTTCTCTCCTTGATTCGCTTCATTACAAT
GATCCTATAGCCCGAGACTTGATCATGGAGCTATTATTCGACGCCCTGCGAATAAAACCCCCGTCCTGGTCGTCA
TCTTTCCTTGCGGGCAGAAGACTCACAACTTATGGCAGAGTCTCGAATCTTCGCTCTGACCTTGAAACATCAAGA
GCCAGCCGCGCTCTCAATGACACCAATAGCAACAGATTTGATCTGACTGCTCATTTCTCTACTCTCATATTGGCC
GGTTTGGTTGAGGCAGGGCTCCCAAAGGTTCTCTCCGACGTCATCGAGGATGAATCGGATCTCTCGCTCAGACGT
AAAGCAACTCTGTTATTGACGGAGGTTCTCAAGCTTGCCCAGCATTCTTTACCCCAAGCCGTCAGCGCACAACTT
CAAGTGCTTCCACACCTAATCCCACCCGCAGTCGACTTTGAAACTGAGAATCACGACCTTTCAACCGCAACTATC
TTCCAAATCGATAGTATCAATCGGACATTGGCGCGTTCTGGTGGATATCCCAGTGGGCAGGGTCGATACAACATG
GAGACAGATTTATCAGTTTCTCTGCTCCCTGCTGAGCAAGGGAAGGACAAGATGAGTCCTTCCATGGACGAGACC
CAGTTCCGCAATGCTATTCTGGAGACTCATGTCCTGAACACCGTCAACTTCAATAAGTGGAAATGGGATATTATT
CATCGTCTAGTGGAGGGTCCTCTTACGAATCCAAAAAGAATGGATGAGGCAATCAAAGGCTCCAAGTTCATGAAA
CGTCTCATTGGGTTTTACCGACCTTTCAAATATCGCTTTGCCATGGTTCCAAACACAAAAGCAAATCAACGATAT
GTCCGAACCGGCTGTGTTCTCATGCGCACTCTCGTTATGACCCCCGAGGGCACCAAGTATCTGGCAGAGAACAAA
TTCCTTCGCCAGGTTGCAGAATGTCTGGCCCAACTGGACCGCATGAGTGGTCTGACGTCTGCATCCCCGCTTTTC
TCCAAAGACCAGATGGCCAATACTCTCAGTGGAGGCTACTTTGCGATGCTAGGGTCATTGAGCGGCGATGTCAAC
GGGCTGCTCATGATGGAACGATGGCATATGCTCAACATGTTTTACCACATCATTGAGTTGCAAGATCGCAACGAT
CTGATTCAGACTTTGCTAGGAAACATGGATTACAGCCGCGAAAGTCATCTCCGCGTCATGCTCTCCAAGGCGTTA
ACAATTGGCTCCAAGGATATCCGAATATTTGCAACCAGATTCCTACGCAAATATGCTGTTGGGGATGTAACGCTT
TCGCCTCAAGTGGCGATTGACAATGCAGAATGGGTGGTCAAACTTCTTGTCACCCAATTGTATGATCCCGAGGTC
ACTGTCTGCCAGGTCGCCGTGAAAATTCTGGAAGAAGCATGCAATCAACGGGATTATCTGGAGTTCGTGGTCAAA
TGTCGACCCTCTCTTGATCATCTAGGTGAAATTGGTGCACCGCTACTTCTCAGATTCCTATCGACTTCCGTGGGA
TATCACTATCTGGATGGTCTTGATTACATCACCCAAGAGATGGATGACTGGTTCCTTGGCCGCAATGATAGCTAT
GTCGGTCTTGTTGAGGCAGCTCTTTCCCGAGCTTACGTCGAGCAACCGCGCCGTGGAAGCCTTGTACCCGAGGAT
CTGGTGGACCTCCAGGATATTGGGTTGGTACCACCGCATTTCTACCGAGAACTTGCACGAACTGCCGAGGGGTGT
AAGCTACTAGAACAATCGGGCCATTTCAATGAATTTGCTTGGACGATTCGTGATTTCAGGCTGGATGAAGAAGAC
AACGAAATGCTTCTCAAAGCTAAAGGATGCCTCTGGGCTGTCGGCAATATTGGCTCAATGGAGCTTGGCGCACCA
TTCTTGGATGCTGAGATTATCCAACGGATTGTGCAGATAGCAACCAGTGCAGGAGTTCTCACTATGCGAGGCACT
GCTTTCTTTGTTTTGGGCTTGATATCTCGCAGTCGACACGGACTCCAAGTCCTGCGGGGTTTGGGCTGGGATTCC
GGGGTTGACCAAAAGGGAGATTCACTGGGACTTTGTCTCCCTACCGATTTCCGAAAATTATTCTTGATTTCCTTC
CCTGGCTTTGATTATAGATCGAAGCGAACTCCCAAGGAGAAACTCAAGGAAGCCACCACCGACTCCGATCCCGGC
AATCAGCGGATCTTAAAGTTGATCGTCGATATGGGCAACACGGTACTCTCCAAAAGAGCCGCTTCTGATCTTCAC
ATCCTAAAATCTAAACAACCGGAGCGATTCCACCAAGCACATCTCTTCCGCAAGACCCTATGCATTCTGGAAAGT
CATCATTATAGACTCCCAGCTCGACGTTTCGCCTTGGACTTATTCGACAAGAGTGTCATGCGACGAATCGTCCTT
GATGAAGATTCCGACTCGGAATCGGACTCATCTACTACTTCCCAGTCAGAATAA
Transcript >Pro_DTO377G3_2|g7040.t1
ATGGCTTCCGGGCACAACTCAGCATACTCCGCGTCGACTCATCATCGTGCACTGGGTGATGGACGATCCTCGCTC
AGTCAGGATGGCGGCTCTGCCGATGGGAGCTGGCAGGACAGTATCTCACGAATCGGGAGGAACAGGCGATCCGAG
TCTGGAGGGAGCAGCAACATGGGCGGACGGGGAGGATCATTGGCGCCCTCGTTAGCTCCCTCCATCGGTGGACCA
GGGAGCTTTAGTTCGGAGCTCAAAAGCACCACTTCACGCAGTGTCACGCCTCGGCCGGACGACCAATATAACAGA
CGTGCGAGCAGATCGATCGGCGAGGCAGACTTTCACACAACCGAACAGCGACAGGCTTTCCTTCGAGACAGAATC
GCGAAGGAAATGAAGATCAAAAGCGGAACCGAGAATATGCTGGAGGCACTGCTAGCAAAACCACCAAAGCAAACG
AAAGAGCAGCGTCTCAAGGTGGAGTCGGAATTGAGCTCATCGAACCGCAAGCTGATCGAATTGCAGCATGAGTTG
GAAGAAGAAATATTACGTGCGCAGGCGCCGGCATCGACTCCTCCACGCGGCAATCGCCTTTCGAGCCTTTTCCGA
GCCAGTCCCATGCGCTCACCATCACGAAACAAGGATGCCGTCGGATCGGTAAATGGTGATAGGGAGGAATATGGT
GATGGTGACGTGGAGTCACCAACCTATGTCCTCTCAGAAACGCTGCAGGCGTTGGAGATAGAGGGGATGTCGCCT
GATTTCTATGTCGAGCGCGCCAATAGCTTGGTTGAATTATTCAAACGGCATCCCACATTGAAGTATGACCTCGCG
TGGTCTGTTTTTGGCCTACGCGTTCAAGTTATGCTTCTAAGTGACAGTAAAGAGGTGGTAGCTGCGGGTTATCGA
CTAACACGCTATGCTATCGCTGATCGCAAATCCCTACAAATCATCCGAACACTCCACACCGACGAGCTGGTGATA
TTGTCCCTGGTCAAAGAAACCAAGGCAAGCATTGAGAGGGAACAGGCCCTGAAGTTTGTGAGAGGCTTCCTGGAT
GTCAAAGACGGTGTCCGAGAGATATCACGCGCCGTTGTGCGGACCATCGTTGCTATTGCTGAACATCATGAAGAC
CGTCTTCGGAACATTTCAATCATGACCGTGGCTGAGATGTTGGTCAAAGACCCTGAACTGGTTGCTTCTGCCGGT
GGATTTGCTGCCCTGCACGACGCGCTTGCAGAGGGGACGTTCGGCGCCTCAGAGTCTCTGATATCAAGTTTTCTG
CATGTTGTGGACACCCCCCGTAGTCGGAAGTTTCTTCAAGGGTCTGAACTTGAAGCTGTTCTTACGCCTTTCACG
GATTCATTATCCGACACATTACGCAGTGGGCGATTAAAGTCGGCAGCGCGAGCCATTTCTGCGATGCTGAAGACT
TGGCCCGGACTGGTTATTCTTGCAAGACATGACTCACAACCGTTGCGTTCTCTCCTTGATTCGCTTCATTACAAT
GATCCTATAGCCCGAGACTTGATCATGGAGCTATTATTCGACGCCCTGCGAATAAAACCCCCGTCCTGGTCGTCA
TCTTTCCTTGCGGGCAGAAGACTCACAACTTATGGCAGAGTCTCGAATCTTCGCTCTGACCTTGAAACATCAAGA
GCCAGCCGCGCTCTCAATGACACCAATAGCAACAGATTTGATCTGACTGCTCATTTCTCTACTCTCATATTGGCC
GGTTTGGTTGAGGCAGGGCTCCCAAAGGTTCTCTCCGACGTCATCGAGGATGAATCGGATCTCTCGCTCAGACGT
AAAGCAACTCTGTTATTGACGGAGGTTCTCAAGCTTGCCCAGCATTCTTTACCCCAAGCCGTCAGCGCACAACTT
CAAGTGCTTCCACACCTAATCCCACCCGCAGTCGACTTTGAAACTGAGAATCACGACCTTTCAACCGCAACTATC
TTCCAAATCGATAGTATCAATCGGACATTGGCGCGTTCTGGTGGATATCCCAGTGGGCAGGGTCGATACAACATG
GAGACAGATTTATCAGTTTCTCTGCTCCCTGCTGAGCAAGGGAAGGACAAGATGAGTCCTTCCATGGACGAGACC
CAGTTCCGCAATGCTATTCTGGAGACTCATGTCCTGAACACCGTCAACTTCAATAAGTGGAAATGGGATATTATT
CATCGTCTAGTGGAGGGTCCTCTTACGAATCCAAAAAGAATGGATGAGGCAATCAAAGGCTCCAAGTTCATGAAA
CGTCTCATTGGGTTTTACCGACCTTTCAAATATCGCTTTGCCATGGTTCCAAACACAAAAGCAAATCAACGATAT
GTCCGAACCGGCTGTGTTCTCATGCGCACTCTCGTTATGACCCCCGAGGGCACCAAGTATCTGGCAGAGAACAAA
TTCCTTCGCCAGGTTGCAGAATGTCTGGCCCAACTGGACCGCATGAGTGGTCTGACGTCTGCATCCCCGCTTTTC
TCCAAAGACCAGATGGCCAATACTCTCAGTGGAGGCTACTTTGCGATGCTAGGGTCATTGAGCGGCGATGTCAAC
GGGCTGCTCATGATGGAACGATGGCATATGCTCAACATGTTTTACCACATCATTGAGTTGCAAGATCGCAACGAT
CTGATTCAGACTTTGCTAGGAAACATGGATTACAGCCGCGAAAGTCATCTCCGCGTCATGCTCTCCAAGGCGTTA
ACAATTGGCTCCAAGGATATCCGAATATTTGCAACCAGATTCCTACGCAAATATGCTGTTGGGGATGTAACGCTT
TCGCCTCAAGTGGCGATTGACAATGCAGAATGGGTGGTCAAACTTCTTGTCACCCAATTGTATGATCCCGAGGTC
ACTGTCTGCCAGGTCGCCGTGAAAATTCTGGAAGAAGCATGCAATCAACGGGATTATCTGGAGTTCGTGGTCAAA
TGTCGACCCTCTCTTGATCATCTAGGTGAAATTGGTGCACCGCTACTTCTCAGATTCCTATCGACTTCCGTGGGA
TATCACTATCTGGATGGTCTTGATTACATCACCCAAGAGATGGATGACTGGTTCCTTGGCCGCAATGATAGCTAT
GTCGGTCTTGTTGAGGCAGCTCTTTCCCGAGCTTACGTCGAGCAACCGCGCCGTGGAAGCCTTGTACCCGAGGAT
CTGGTGGACCTCCAGGATATTGGGTTGGTACCACCGCATTTCTACCGAGAACTTGCACGAACTGCCGAGGGGTGT
AAGCTACTAGAACAATCGGGCCATTTCAATGAATTTGCTTGGACGATTCGTGATTTCAGGCTGGATGAAGAAGAC
AACGAAATGCTTCTCAAAGCTAAAGGATGCCTCTGGGCTGTCGGCAATATTGGCTCAATGGAGCTTGGCGCACCA
TTCTTGGATGCTGAGATTATCCAACGGATTGTGCAGATAGCAACCAGTGCAGGAGTTCTCACTATGCGAGGCACT
GCTTTCTTTGTTTTGGGCTTGATATCTCGCAGTCGACACGGACTCCAAGTCCTGCGGGGTTTGGGCTGGGATTCC
GGGGTTGACCAAAAGGGAGATTCACTGGGACTTTGTCTCCCTACCGATTTCCGAAAATTATTCTTGATTTCCTTC
CCTGGCTTTGATTATAGATCGAAGCGAACTCCCAAGGAGAAACTCAAGGAAGCCACCACCGACTCCGATCCCGGC
AATCAGCGGATCTTAAAGTTGATCGTCGATATGGGCAACACGGTACTCTCCAAAAGAGCCGCTTCTGATCTTCAC
ATCCTAAAATCTAAACAACCGGAGCGATTCCACCAAGCACATCTCTTCCGCAAGACCCTATGCATTCTGGAAAGT
CATCATTATAGACTCCCAGCTCGACGTTTCGCCTTGGACTTATTCGACAAGAGTGTCATGCGACGAATCGTCCTT
GATGAAGATTCCGACTCGGAATCGGACTCATCTACTACTTCCCAGTCAGAATAA
Gene >Pro_DTO377G3_2|g7040.t1
ATGGCTTCCGGGCACAACTCAGCATACTCCGCGTCGACTCATCATCGTGCACTGGGTGATGGACGATCCTCGCTC
AGTCAGGATGGCGGCTCTGCCGATGGGAGCTGGCAGGACAGTATCTCACGAATCGGGAGGAACAGGCGATCCGAG
TCTGGAGGGAGCAGCAACATGGGCGGACGGGGAGGATCATTGGCGCCCTCGTTAGCTCCCTCCATCGGTGGACCA
GGGAGCTTTAGTTCGGAGCTCAAAAGCACCACTTCACGCAGTGTCACGCCTCGGCCGGACGACCAATATAACAGA
CGTGCGAGCAGATCGATCGGCGAGGCAGACTTTCACACAACCGAACAGCGACAGGCTTTCCTTCGAGACAGAATC
GCGAAGGAAATGAAGATCAAAAGCGGAACCGAGAATATGCTGGAGGCACTGCTAGCAAAACCACCAAAGCAAACG
AAAGAGCAGCGTCTCAAGGTGGAGTCGGAATTGAGCTCATCGAACCGCAAGCTGATCGAATTGCAGCATGAGTTG
GAAGAAGAAATATTACGTGCGCAGGCGCCGGCATCGACTCCTCCACGCGGCAATCGCCTTTCGAGCCTTTTCCGA
GCCAGTCCCATGCGCTCACCATCACGAAACAAGGATGCCGTCGGATCGGTAAATGGTGATAGGGAGGAATATGGT
GATGGTGACGTGGAGTCACCAACCTATGTCCTCTCAGAAACGCTGCAGGCGTTGGAGATAGAGGGGATGTCGCCT
GATTTCTATGTCGAGCGCGCCAATAGCTTGGTTGAATTATTCAAACGGCATCCCACATTGAAGTATGACCTCGCG
TGGTCTGTTTTTGGCCTACGCGTTCAAGTTATGCTTCTAAGTGACAGTAAAGAGGTGGTAGCTGCGGGTTATCGA
CTAACACGCTATGCTATCGCTGATCGCAAATCCCTACAAATCATCCGAACACTCCACACCGACGAGCTGGTGATA
TTGTCCCTGGTCAAAGAAACCAAGGCAAGCATTGAGAGGGAACAGGCCCTGAAGTTTGTGAGAGGCTTCCTGGAT
GTCAAAGACGGTGTCCGAGAGATATCACGCGCCGTTGTGCGGACCATCGTTGCTATTGCTGAACATCATGAAGAC
CGTCTTCGGAACATTTCAATCATGACCGTGGCTGAGATGTTGGTCAAAGACCCTGAACTGGTTGCTTCTGCCGGT
GGATTTGCTGCCCTGCACGACGCGCTTGCAGAGGGGACGTTCGGCGCCTCAGAGTCTCTGATATCAAGTTTTCTG
CATGTTGTGGACACCCCCCGTAGTCGGAAGTTTCTTCAAGGGTCTGAACTTGAAGCTGTTCTTACGCCTTTCACG
GATTCATTATCCGACACATTACGCAGTGGGCGATTAAAGTCGGCAGCGCGAGCCATTTCTGCGATGCTGAAGACT
TGGCCCGGACTGGTTATTCTTGCAAGACATGACTCACAACCGTTGCGTTCTCTCCTTGATTCGCTTCATTACAAT
GATCCTATAGCCCGAGACTTGATCATGGAGCTATTATTCGACGCCCTGCGAATAAAACCCCCGTCCTGGTCGTCA
TCTTTCCTTGCGGGCAGAAGACTCACAACTTATGGCAGAGTCTCGAATCTTCGCTCTGACCTTGAAACATCAAGA
GCCAGCCGCGCTCTCAATGACACCAATAGCAACAGATTTGATCTGACTGCTCATTTCTCTACTCTCATATTGGCC
GGTTTGGTTGAGGCAGGGCTCCCAAAGGTATGTATTTTTTTTACCCCTAGGCCTGGCTTAGCGCAAGAGTTAACC
GAATACAGGTTCTCTCCGACGTCATCGAGGATGAATCGGATCTCTCGCTCAGACGTAAAGCAACTCTGTTATTGA
CGGAGGTTCTCAAGCTTGCCCAGCATTCTTTACCCCAAGCCGTCAGCGCACAACTTCAAGTGCTTCCACACCTAA
TCCCACCCGCAGTCGACTTTGAAACTGAGAATCACGACCTTTCAACCGCAACTATCTTCCAAATCGATAGTATCA
ATCGGACATTGGCGCGTTCTGGTGGATATCCCAGTGGGCAGGGTCGATACAACATGGAGACAGATTTATCAGTTT
CTCTGCTCCCTGCTGAGCAAGGGAAGGACAAGATGAGTCCTTCCATGGACGAGACCCAGTTCCGCAATGCTATTC
TGGAGACTCATGTCCTGAACACCGTCAACTTCAATAAGTGGAAATGGGATATTATTCATCGTCTAGTGGAGGGTC
CTCTTACGAATCCAAAAAGAATGGATGAGGCAATCAAAGGCTCCAAGTTCATGAAACGTCTCATTGGGTTTTACC
GACCTTTCAAATATCGCTTTGCCATGGTTCCAAACACAAAAGCAAATCAACGATATGTCCGAACCGGCTGTGTTC
TCATGCGCACTCTCGTTATGACCCCCGAGGGCACCAAGTATCTGGCAGAGAACAAATTCCTTCGCCAGGTTGCAG
AATGTCTGGCCCAACTGGACCGCATGAGTGGTCTGACGTCTGCATCCCCGCTTTTCTCCAAAGACCAGATGGCCA
ATACTCTCAGTGGAGGCTACTTTGCGATGCTAGGGTCATTGAGCGGCGATGTCAACGGGCTGCTCATGATGGAAC
GATGGCATATGCTCAACATGTTTTACCACATCATTGAGTTGCAAGATCGCAACGATCTGATTCAGACTTTGCTAG
GAAACATGGATTACAGCCGCGAAAGTCATCTCCGCGTCATGCTCTCCAAGGCGTTAACAATTGGCTCCAAGGATA
TCCGAATATTTGCAACCAGATTCCTACGCAAATATGCTGTTGGGGATGTAACGCTTTCGCCTCAAGTGGCGATTG
ACAATGCAGAATGGGTGGTCAAACTTCTTGTCACCCAATTGTATGATCCCGAGGTCACTGTCTGCCAGGTCGCCG
TGAAAATTCTGGAAGAAGCATGCAATCAACGGGATTATCTGGAGTTCGTGGTCAAATGTCGACCCTCTCTTGATC
ATCTAGGTGAAATTGGTGCACCGCTACTTCTCAGATTCCTATCGACTTCCGTGGGATATCACTATCTGGATGGTC
TTGATTACATCACCCAAGAGATGGATGACTGGTTCCTTGGCCGCAATGATAGCTATGTCGGTCTTGTTGAGGCAG
CTCTTTCCCGAGCTTACGTCGAGCAACCGCGCCGTGGAAGCCTTGTACCCGAGGATCTGGTGGACCTCCAGGATA
TTGGGTTGGTACCACCGCATTTCTACCGAGAACTTGCACGAACTGCCGAGGGGTGTAAGCTACTAGAACAATCGG
GCCATTTCAATGAATTTGCTTGGACGATTCGTGATTTCAGGCTGGATGAAGAAGACAACGAAATGCTTCTCAAAG
CTAAAGGATGCCTCTGGGCTGTCGGCAATATTGGCTCAATGGAGCTTGGCGCACCATTCTTGGATGCTGAGATTA
TCCAACGGATTGTGCAGATAGCAACCAGTGCAGGAGTTCTCACTATGCGAGGCACTGCTTTCTTTGTTTTGGGCT
TGATATCTCGCAGTCGACACGGACTCCAAGTCCTGCGGGGTTTGGGCTGGGATTCCGGGGTTGACCAAAAGGGAG
ATTCACTGGGACTTTGTCTCCCTACCGATTTCCGAAAATTATTCTTGGTGAGTATCTTCTGTCCCTTCACTTTCG
TCTCATTGTACTCATCCATCTAGATTTCCTTCCCTGGCTTTGATTATAGATCGAAGCGAACTCCCAAGGAGAAAC
TCAAGGAAGCCACCACCGACTCCGATCCCGGCAATCAGCGGATCTTAAAGTTGATCGTCGATATGGGCAACACGG
TACTCTCCAAAAGAGCCGCTTCTGATCTTCACATGTATGGCTCTCAGTTTTCATTCCGCGACTTCTTACATTTGC
TCACAATTCTCAACCACAGCCTAAAATCTAAACAACCGGAGCGATTCCACCAAGCACATCTCTTCCGCAAGACCC
TATGCATTCTGGAAAGTCATCATTATAGACTCCCAGCTCGACGTTTCGCCTTGGACTTATTCGACAAGAGTGTCA
TGCGACGAATCGTCCTTGATGAAGATTCCGACTCGGAATCGGACTCATCTACTACTTCCCAGTCAGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail