Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7034.t1
Gene name
Locationscaffold_20:283242..284806
Strand-
Gene length (bp)1564
Transcript length (bp)1428
Coding sequence length (bp)1428
Protein length (aa) 476

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10255 Paf67 RNA polymerase I-associated factor PAF67 2.8E-159 75 473

GO

GO Term Description Terminal node
GO:0005852 eukaryotic translation initiation factor 3 complex Yes
GO:0005737 cytoplasm Yes
GO:0003743 translation initiation factor activity Yes
GO:0090079 translation regulator activity, nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0003723 RNA binding No
GO:0044444 cytoplasmic part No
GO:0005488 binding No
GO:0044424 intracellular part No
GO:0005575 cellular_component No
GO:0003676 nucleic acid binding No
GO:0032991 protein-containing complex No
GO:0008135 translation factor activity, RNA binding No
GO:0044464 cell part No
GO:0045182 translation regulator activity No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 194 216 22
2 229 251 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7034.t1
MSYDDRANARPNLNDESDNEEEAMVNDYREQVNFDDGMSELDQTMSHGGGQAQDLQAQLAAAATPLEYQATLETK
FASYDNYCSLFHYILNSDGPVDLEVPNYYWAWEVIDEFIYQFESFCRYRNRVARTGSNEEESQLLRENPNTWGCY
SVLNVLYSLIQRSQISEQLNATKRGEDPMAVAGEYGSRPLYKMLGYFSIIGLLRVHCLLGDFSLALKILDDVEMN
KKAMFARVMAAHFTTYYYVGFSYMMMRRYGDAIRMFSHILVYVSRTKNFQKGGNNYEAIAKKNDQMYALIAICVA
LHPTRLDDTIHSAVREKYGEQFYRMQKGGPEALPVFEELFRSSCPKFINPTPPDFDNPASNVDPVDHHTAIFMDE
VKNTLFNPTIRSYLKLYTTMDLKKLAGFLEVSPEQLRSWLLVNKQRSRQIRWVDGGLLDGEPAIANDLDYALEDD
LIHVSETKAGRRLVDWYLRNLARVY*
Coding >Pro_DTO377G3_2|g7034.t1
ATGTCCTACGACGACCGCGCCAATGCGCGCCCCAACTTGAACGATGAGTCCGATAATGAGGAGGAGGCTATGGTC
AACGACTACCGCGAGCAGGTCAACTTCGACGATGGAATGAGCGAGCTGGACCAGACCATGTCCCACGGTGGAGGG
CAGGCTCAAGACCTTCAGGCCCAACTGGCCGCCGCCGCCACTCCGTTGGAATACCAGGCTACTCTTGAGACCAAA
TTCGCCAGCTACGACAACTACTGCAGTCTGTTCCACTATATCCTGAACTCCGATGGCCCCGTGGATTTGGAGGTT
CCTAATTACTACTGGGCTTGGGAAGTCATTGATGAGTTCATTTACCAATTCGAGTCCTTCTGCCGTTACCGCAAC
CGCGTTGCTCGCACTGGATCCAACGAGGAGGAGAGCCAGCTGCTCCGCGAGAACCCGAACACATGGGGCTGCTAC
TCAGTGCTGAACGTGCTTTACTCTCTCATTCAGCGCTCGCAGATCAGCGAACAATTGAACGCCACTAAGCGCGGA
GAGGACCCAATGGCTGTCGCCGGCGAGTACGGCTCCCGCCCCTTGTACAAGATGCTCGGCTACTTCTCGATCATC
GGACTGCTGCGCGTGCACTGCCTGCTCGGCGACTTCAGTCTTGCCCTGAAGATCCTCGACGATGTCGAGATGAAC
AAGAAGGCCATGTTCGCCCGCGTGATGGCCGCCCACTTCACCACCTACTACTACGTGGGCTTCTCCTACATGATG
ATGCGCCGCTACGGCGACGCCATCCGCATGTTCAGCCACATCCTCGTGTATGTGTCCCGGACAAAGAACTTCCAG
AAGGGCGGCAACAACTACGAAGCCATCGCCAAGAAGAACGACCAGATGTACGCCCTGATCGCTATCTGTGTGGCT
CTCCACCCCACCCGTCTGGATGACACCATCCACTCGGCCGTCCGCGAGAAGTACGGCGAGCAGTTTTACCGTATG
CAGAAGGGTGGCCCCGAGGCCCTGCCCGTCTTTGAGGAGCTCTTCCGCTCTTCCTGCCCTAAGTTCATCAACCCT
ACTCCTCCCGACTTCGACAACCCCGCCTCCAACGTCGACCCCGTCGACCACCACACCGCCATCTTCATGGATGAG
GTCAAGAACACCCTGTTCAACCCCACCATCCGCTCTTACCTAAAGCTCTACACTACCATGGACCTCAAGAAACTT
GCAGGTTTCCTCGAGGTGTCCCCCGAGCAGCTCCGCTCGTGGCTGCTCGTTAACAAGCAGCGCAGCCGCCAGATC
CGCTGGGTCGATGGTGGCCTTCTGGATGGCGAGCCTGCCATCGCCAACGATCTCGACTACGCTCTTGAGGACGAC
CTGATCCATGTCAGCGAGACCAAGGCTGGCCGTCGTCTGGTCGACTGGTACCTGCGTAACCTCGCTCGTGTCTAC
TAA
Transcript >Pro_DTO377G3_2|g7034.t1
ATGTCCTACGACGACCGCGCCAATGCGCGCCCCAACTTGAACGATGAGTCCGATAATGAGGAGGAGGCTATGGTC
AACGACTACCGCGAGCAGGTCAACTTCGACGATGGAATGAGCGAGCTGGACCAGACCATGTCCCACGGTGGAGGG
CAGGCTCAAGACCTTCAGGCCCAACTGGCCGCCGCCGCCACTCCGTTGGAATACCAGGCTACTCTTGAGACCAAA
TTCGCCAGCTACGACAACTACTGCAGTCTGTTCCACTATATCCTGAACTCCGATGGCCCCGTGGATTTGGAGGTT
CCTAATTACTACTGGGCTTGGGAAGTCATTGATGAGTTCATTTACCAATTCGAGTCCTTCTGCCGTTACCGCAAC
CGCGTTGCTCGCACTGGATCCAACGAGGAGGAGAGCCAGCTGCTCCGCGAGAACCCGAACACATGGGGCTGCTAC
TCAGTGCTGAACGTGCTTTACTCTCTCATTCAGCGCTCGCAGATCAGCGAACAATTGAACGCCACTAAGCGCGGA
GAGGACCCAATGGCTGTCGCCGGCGAGTACGGCTCCCGCCCCTTGTACAAGATGCTCGGCTACTTCTCGATCATC
GGACTGCTGCGCGTGCACTGCCTGCTCGGCGACTTCAGTCTTGCCCTGAAGATCCTCGACGATGTCGAGATGAAC
AAGAAGGCCATGTTCGCCCGCGTGATGGCCGCCCACTTCACCACCTACTACTACGTGGGCTTCTCCTACATGATG
ATGCGCCGCTACGGCGACGCCATCCGCATGTTCAGCCACATCCTCGTGTATGTGTCCCGGACAAAGAACTTCCAG
AAGGGCGGCAACAACTACGAAGCCATCGCCAAGAAGAACGACCAGATGTACGCCCTGATCGCTATCTGTGTGGCT
CTCCACCCCACCCGTCTGGATGACACCATCCACTCGGCCGTCCGCGAGAAGTACGGCGAGCAGTTTTACCGTATG
CAGAAGGGTGGCCCCGAGGCCCTGCCCGTCTTTGAGGAGCTCTTCCGCTCTTCCTGCCCTAAGTTCATCAACCCT
ACTCCTCCCGACTTCGACAACCCCGCCTCCAACGTCGACCCCGTCGACCACCACACCGCCATCTTCATGGATGAG
GTCAAGAACACCCTGTTCAACCCCACCATCCGCTCTTACCTAAAGCTCTACACTACCATGGACCTCAAGAAACTT
GCAGGTTTCCTCGAGGTGTCCCCCGAGCAGCTCCGCTCGTGGCTGCTCGTTAACAAGCAGCGCAGCCGCCAGATC
CGCTGGGTCGATGGTGGCCTTCTGGATGGCGAGCCTGCCATCGCCAACGATCTCGACTACGCTCTTGAGGACGAC
CTGATCCATGTCAGCGAGACCAAGGCTGGCCGTCGTCTGGTCGACTGGTACCTGCGTAACCTCGCTCGTGTCTAC
TAA
Gene >Pro_DTO377G3_2|g7034.t1
ATGTCCTACGACGACCGCGCCAATGCGCGCCCCAACTTGAACGATGAGTCCGATAATGAGGAGGAGGCTATGGTC
AACGACTACCGCGAGCAGGTCAACTTCGACGATGGAATGAGCGAGCTGGACCAGACCATGTCCCACGGTGGAGGG
CAGGCTCAAGACCTTCAGGCCCAACTGGCCGCCGCCGCCACTCCGTTGGAATACCAGGCTACTCTTGAGACCAAA
TTCGCCAGCTACGACAACTACTGCAGTCTGTTCCACTATATCCTGAACTCCGATGGCCCCGTGGATTTGGAGGTT
CCTAATGTAGGTATTCCGTTTTGCCGACCGATTGTTGAACGCCATGAATGAAAAGTAAAAGCTTGGCATTCGTGA
AATCAACAAGTCGATTCATCCCTCCAAAAGACAATATGGATAACTAACAATGCTTTTCTACAATCAGTACTACTG
GGCTTGGGAAGTCATTGATGAGTTCATTTACCAATTCGAGTCCTTCTGCCGTTACCGCAACCGCGTTGCTCGCAC
TGGATCCAACGAGGAGGAGAGCCAGCTGCTCCGCGAGAACCCGAACACATGGGGCTGCTACTCAGTGCTGAACGT
GCTTTACTCTCTCATTCAGCGCTCGCAGATCAGCGAACAATTGAACGCCACTAAGCGCGGAGAGGACCCAATGGC
TGTCGCCGGCGAGTACGGCTCCCGCCCCTTGTACAAGATGCTCGGCTACTTCTCGATCATCGGACTGCTGCGCGT
GCACTGCCTGCTCGGCGACTTCAGTCTTGCCCTGAAGATCCTCGACGATGTCGAGATGAACAAGAAGGCCATGTT
CGCCCGCGTGATGGCCGCCCACTTCACCACCTACTACTACGTGGGCTTCTCCTACATGATGATGCGCCGCTACGG
CGACGCCATCCGCATGTTCAGCCACATCCTCGTGTATGTGTCCCGGACAAAGAACTTCCAGAAGGGCGGCAACAA
CTACGAAGCCATCGCCAAGAAGAACGACCAGATGTACGCCCTGATCGCTATCTGTGTGGCTCTCCACCCCACCCG
TCTGGATGACACCATCCACTCGGCCGTCCGCGAGAAGTACGGCGAGCAGTTTTACCGTATGCAGAAGGGTGGCCC
CGAGGCCCTGCCCGTCTTTGAGGAGCTCTTCCGCTCTTCCTGCCCTAAGTTCATCAACCCTACTCCTCCCGACTT
CGACAACCCCGCCTCCAACGTCGACCCCGTCGACCACCACACCGCCATCTTCATGGATGAGGTCAAGAACACCCT
GTTCAACCCCACCATCCGCTCTTACCTAAAGCTCTACACTACCATGGACCTCAAGAAACTTGCAGGTTTCCTCGA
GGTGTCCCCCGAGCAGCTCCGCTCGTGGCTGCTCGTTAACAAGCAGCGCAGCCGCCAGATCCGCTGGGTCGATGG
TGGCCTTCTGGATGGCGAGCCTGCCATCGCCAACGATCTCGACTACGCTCTTGAGGACGACCTGATCCATGTCAG
CGAGACCAAGGCTGGCCGTCGTCTGGTCGACTGGTACCTGCGTAACCTCGCTCGTGTCTACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail