Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7027.t1
Gene name
Locationscaffold_20:265137..267564
Strand+
Gene length (bp)2427
Transcript length (bp)2019
Coding sequence length (bp)2019
Protein length (aa) 673

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06087 Tyr-DNA_phospho Tyrosyl-DNA phosphodiesterase 1.8E-82 226 660

GO

GO Term Description Terminal node
GO:0006281 DNA repair Yes
GO:0008081 phosphoric diester hydrolase activity Yes
GO:0005634 nucleus Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0005575 cellular_component No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0006259 DNA metabolic process No
GO:0033554 cellular response to stress No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003824 catalytic activity No
GO:0043229 intracellular organelle No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006950 response to stress No
GO:0006974 cellular response to DNA damage stimulus No
GO:0016787 hydrolase activity No
GO:0050896 response to stimulus No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0051716 cellular response to stimulus No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7027.t1
MEPQVDPELTAAIEASRQDMYRQQNRQASQDNFVDLTNDSGDDSDIEEVFPKSKSVVSSETEDGDEHEQLQRALA
MSMEQDAQSPKHATAPHEVSAASTGSILGMNRKQMEEERLARLAKRKTGNSLSESKVDDTTSKRKANDTSSKRKA
DDTSSTLPSPVSRKLPRTEPLPARHSVALANPFQDAPQASTARVRSQVCRQLATNAPNVDIQPTSCSVAQWPLGA
VKKTHIAGFPRSGNDITIEEVIQRGDLELGVFSSFMWDMPWLCSKFNNLTTRIIFVMQANDEETREQYRQDVSHM
PNFRLCFPPMEPQVFCMHSKLLLMFHPGYLRIAVPSANLTPTDWGEDRLMENTVFLIDLPKLEVPGAGKTPFYKE
LVYFLQAEELHRNIIKRLDEFDFSETKRYAFVHAVGGTSTEDNWKRTGVSGLGRAVKALGLETNAPINVDYIASS
LGNINIPFLRSIYLACKGDNALLEYELRTANKKKEPRTEVEAINRECLDHFRIYFPSDQTVRAVHSNPKYSIGTI
CLNPAWWSGANFPRDKVRDCVSERGVLMHNKIAFVHPSTPIDMPDKKECRGWAYVGSANLSESAWGRIVKDTKTK
QLKISCRNWECGVIVPIINEKKTGEKDKGPETHGTAPSASLPVEIFTDTVPVPIKVPAVPLSEHRKPFFFGV*
Coding >Pro_DTO377G3_2|g7027.t1
ATGGAGCCACAAGTGGATCCTGAGTTAACCGCTGCCATCGAGGCCTCTCGCCAAGATATGTATCGCCAGCAGAAC
AGGCAAGCGTCCCAGGATAATTTTGTGGATCTCACCAATGACTCAGGTGATGACTCGGACATTGAGGAGGTATTC
CCCAAATCAAAGTCCGTCGTTAGTTCCGAGACCGAAGATGGCGACGAGCACGAGCAGCTGCAACGCGCCCTTGCT
ATGTCGATGGAGCAGGATGCACAGTCTCCCAAACATGCTACTGCCCCGCATGAGGTCTCTGCAGCGTCGACGGGT
TCAATTTTGGGCATGAACCGAAAGCAGATGGAGGAGGAGCGTCTTGCACGTCTGGCCAAGCGCAAGACCGGCAAC
TCTTTGTCTGAGAGCAAGGTTGATGATACTACGTCTAAACGTAAGGCCAATGACACTTCATCTAAGCGCAAGGCC
GACGATACTTCGTCGACTCTGCCATCTCCAGTTAGCCGGAAGCTTCCTAGGACTGAGCCTTTGCCAGCCCGTCAC
TCTGTCGCTCTAGCCAACCCGTTTCAAGATGCTCCCCAGGCAAGCACGGCTCGAGTGAGATCTCAAGTCTGTCGC
CAGCTTGCAACAAATGCCCCGAATGTTGACATCCAACCGACCTCCTGCTCAGTGGCCCAATGGCCTCTTGGAGCT
GTCAAAAAAACACATATCGCCGGCTTCCCTCGCAGTGGAAATGACATTACAATTGAAGAAGTTATTCAGCGAGGA
GACTTGGAGTTGGGCGTATTTAGCTCATTTATGTGGGACATGCCGTGGCTTTGTTCCAAGTTTAACAATTTAACC
ACACGAATCATCTTTGTCATGCAAGCAAATGACGAAGAAACGCGAGAGCAATACCGCCAGGACGTTAGCCACATG
CCCAATTTTCGCCTGTGTTTCCCGCCAATGGAGCCACAGGTATTCTGTATGCATTCTAAACTGCTTCTGATGTTT
CACCCTGGATATCTTCGCATCGCAGTCCCCTCCGCCAATCTCACTCCCACTGACTGGGGAGAGGATAGGCTCATG
GAAAACACTGTTTTCCTTATTGATCTGCCTAAGCTCGAAGTTCCTGGTGCTGGAAAGACCCCATTCTACAAAGAA
CTAGTCTACTTCCTCCAGGCCGAGGAACTCCACCGCAACATCATCAAGAGGCTAGATGAGTTTGACTTCAGCGAG
ACGAAGCGCTATGCCTTTGTTCATGCAGTTGGCGGAACAAGCACCGAAGACAACTGGAAACGTACTGGAGTTAGC
GGTTTGGGTCGTGCTGTCAAAGCTCTCGGCCTGGAGACAAACGCGCCCATTAACGTCGACTATATCGCCTCATCG
CTGGGAAATATCAACATTCCATTCCTGCGCTCCATCTACCTCGCTTGCAAAGGTGACAACGCTCTACTAGAGTAC
GAGCTCCGAACCGCAAACAAGAAAAAGGAACCCCGTACAGAAGTGGAAGCGATTAACCGAGAATGTCTCGACCAC
TTCCGTATCTACTTCCCATCAGACCAGACCGTTCGAGCCGTGCACAGCAATCCCAAATATTCTATCGGCACGATA
TGCCTCAATCCAGCCTGGTGGTCGGGTGCCAATTTCCCGCGGGACAAAGTTCGAGACTGTGTGAGCGAGCGCGGA
GTCTTGATGCATAACAAGATTGCCTTTGTCCACCCTTCCACCCCGATCGATATGCCCGATAAGAAGGAGTGCCGG
GGGTGGGCTTATGTGGGGAGTGCGAATTTGTCAGAGAGTGCATGGGGTCGTATCGTCAAGGATACCAAGACGAAA
CAGCTGAAGATAAGCTGTCGCAACTGGGAATGCGGTGTTATCGTGCCCATCATCAATGAGAAGAAGACTGGGGAG
AAAGATAAGGGACCGGAAACGCATGGGACCGCCCCTTCGGCTTCTCTCCCAGTCGAGATCTTTACGGATACCGTT
CCAGTTCCGATTAAAGTGCCCGCTGTTCCATTATCCGAGCACAGGAAGCCTTTCTTCTTTGGAGTTTGA
Transcript >Pro_DTO377G3_2|g7027.t1
ATGGAGCCACAAGTGGATCCTGAGTTAACCGCTGCCATCGAGGCCTCTCGCCAAGATATGTATCGCCAGCAGAAC
AGGCAAGCGTCCCAGGATAATTTTGTGGATCTCACCAATGACTCAGGTGATGACTCGGACATTGAGGAGGTATTC
CCCAAATCAAAGTCCGTCGTTAGTTCCGAGACCGAAGATGGCGACGAGCACGAGCAGCTGCAACGCGCCCTTGCT
ATGTCGATGGAGCAGGATGCACAGTCTCCCAAACATGCTACTGCCCCGCATGAGGTCTCTGCAGCGTCGACGGGT
TCAATTTTGGGCATGAACCGAAAGCAGATGGAGGAGGAGCGTCTTGCACGTCTGGCCAAGCGCAAGACCGGCAAC
TCTTTGTCTGAGAGCAAGGTTGATGATACTACGTCTAAACGTAAGGCCAATGACACTTCATCTAAGCGCAAGGCC
GACGATACTTCGTCGACTCTGCCATCTCCAGTTAGCCGGAAGCTTCCTAGGACTGAGCCTTTGCCAGCCCGTCAC
TCTGTCGCTCTAGCCAACCCGTTTCAAGATGCTCCCCAGGCAAGCACGGCTCGAGTGAGATCTCAAGTCTGTCGC
CAGCTTGCAACAAATGCCCCGAATGTTGACATCCAACCGACCTCCTGCTCAGTGGCCCAATGGCCTCTTGGAGCT
GTCAAAAAAACACATATCGCCGGCTTCCCTCGCAGTGGAAATGACATTACAATTGAAGAAGTTATTCAGCGAGGA
GACTTGGAGTTGGGCGTATTTAGCTCATTTATGTGGGACATGCCGTGGCTTTGTTCCAAGTTTAACAATTTAACC
ACACGAATCATCTTTGTCATGCAAGCAAATGACGAAGAAACGCGAGAGCAATACCGCCAGGACGTTAGCCACATG
CCCAATTTTCGCCTGTGTTTCCCGCCAATGGAGCCACAGGTATTCTGTATGCATTCTAAACTGCTTCTGATGTTT
CACCCTGGATATCTTCGCATCGCAGTCCCCTCCGCCAATCTCACTCCCACTGACTGGGGAGAGGATAGGCTCATG
GAAAACACTGTTTTCCTTATTGATCTGCCTAAGCTCGAAGTTCCTGGTGCTGGAAAGACCCCATTCTACAAAGAA
CTAGTCTACTTCCTCCAGGCCGAGGAACTCCACCGCAACATCATCAAGAGGCTAGATGAGTTTGACTTCAGCGAG
ACGAAGCGCTATGCCTTTGTTCATGCAGTTGGCGGAACAAGCACCGAAGACAACTGGAAACGTACTGGAGTTAGC
GGTTTGGGTCGTGCTGTCAAAGCTCTCGGCCTGGAGACAAACGCGCCCATTAACGTCGACTATATCGCCTCATCG
CTGGGAAATATCAACATTCCATTCCTGCGCTCCATCTACCTCGCTTGCAAAGGTGACAACGCTCTACTAGAGTAC
GAGCTCCGAACCGCAAACAAGAAAAAGGAACCCCGTACAGAAGTGGAAGCGATTAACCGAGAATGTCTCGACCAC
TTCCGTATCTACTTCCCATCAGACCAGACCGTTCGAGCCGTGCACAGCAATCCCAAATATTCTATCGGCACGATA
TGCCTCAATCCAGCCTGGTGGTCGGGTGCCAATTTCCCGCGGGACAAAGTTCGAGACTGTGTGAGCGAGCGCGGA
GTCTTGATGCATAACAAGATTGCCTTTGTCCACCCTTCCACCCCGATCGATATGCCCGATAAGAAGGAGTGCCGG
GGGTGGGCTTATGTGGGGAGTGCGAATTTGTCAGAGAGTGCATGGGGTCGTATCGTCAAGGATACCAAGACGAAA
CAGCTGAAGATAAGCTGTCGCAACTGGGAATGCGGTGTTATCGTGCCCATCATCAATGAGAAGAAGACTGGGGAG
AAAGATAAGGGACCGGAAACGCATGGGACCGCCCCTTCGGCTTCTCTCCCAGTCGAGATCTTTACGGATACCGTT
CCAGTTCCGATTAAAGTGCCCGCTGTTCCATTATCCGAGCACAGGAAGCCTTTCTTCTTTGGAGTTTGA
Gene >Pro_DTO377G3_2|g7027.t1
ATGGAGCCACAAGTGGATCCTGAGTTAACCGCTGCCATCGAGGCCTCTCGCCAAGATATGTATCGCCAGCAGAAC
AGGCAAGCGTCCCAGGATAATTTTGTGGATCTCACCAATGACTCAGGTGATGACTCGGACATTGAGGAGGTATTC
CCCAAATCAAAGTCCGTCGTTAGTTCCGAGACCGAAGATGGCGACGAGCACGAGCAGCTGCAACGCGCCCTTGCT
ATGTCGATGGAGCAGGATGCACAGTCTCCCAAACATGCTACTGCCCCGCATGAGGTCTCTGCAGCGTCGACGGGT
TCAATTTTGGGCATGAACCGAAAGCAGATGGAGGAGGAGCGTCTTGCACGTCTGGCCAAGCGCAAGACCGGCAAC
TCTTTGTCTGAGAGCAAGGTTGATGATACTACGTCTAAACGTAAGGCCAATGACACTTCATCTAAGCGCAAGGCC
GACGATACTTCGTCGACTCTGCCATCTCCAGTTAGCCGGAAGCTTCCTAGGACTGAGCCTTTGCCAGCCCGTCAC
TCTGTCGCTCTAGCCAACCCGTTTCAAGATGCTCCCCAGGCAAGCACGGCTCGAGTGAGATCTCAAGTCTGTCGC
CAGCTTGCAACAAATGCCCCGAATGTTGACATCCAACCGACCTCCTGCTCAGTGGCCCAATGGCCTCTTGGAGCT
GTCAAAAAAACACATATCGCCGGCTTCCCTCGCAGTGGAAATGACATTACAATTGAAGAAGTTATTCAGCGAGGA
GACTTGGAGTTGGGCGTATTTAGCTCATTTATGTGGGACATGCCGTGGCTTTGTTCCAAGTTTAACAATTTAACC
ACACGAATCATCTTTGTCATGCAAGCAAATGACGAAGAAACGGTTAGCAACACACTATGATCTTGAATGATACGG
GCTAACGTGACTTCGCTTACAGCGAGAGCAATACCGCCAGGACGTTAGCCACATGCCCAATTTTCGCCTGTGTTT
CCCGCCAATGGAGCCACAGGTATTCTGTATGCATTCTAAACTGCTTCTGATGTTTCACCCTGGATATCTTCGCAT
CGCAGTCCCCTCCGCCAATCTCACTCCCACTGACTGGGGAGAGGATAGGCTCATGGAAAACGTATGTGGCTACAT
TCGCCTGATGTTCATGGATTTTCTAACAGTGTGCAGACTGTTTTCCTTATTGATCTGCCTAAGCTCGAAGTTCCT
GGTGCTGGAAAGACCCCATTCTACAAAGAACTAGTCTACTTCCTCCAGGCCGAGGAACTCCACCGCAACATCATC
AAGAGGCTAGATGAGTTTGACTTCAGCGAGACGAAGCGCTATGCCTTTGTTCATGCAGTGTATGTATTATCTCCC
TGGGTGATTCCCCTGGCAAAAACCAGCAACCAGCTAACAATCTAAGTGGCGGAACAAGCACCGAAGACAACTGGA
AACGTACTGGAGTTAGCGGTTTGGGTCGTGCTGTCAAAGCTCTCGGCCTGGAGACAAACGCGCCCATTAACGTCG
ACTATATCGTAAGTTTTACCTGCTATGCCTTCATATAATACAATACTGGGTATACTAACAACATTCAGGCCTCAT
CGCTGGGAAATATCAACATTCCATTCCTGCGCTCCATCTACCTCGCTTGCAAAGGTATGTCACCATTTAGTAAAG
CCCAGACGAACTAATCCAACTAACTGCAAACTGCTAGGTGACAACGCTCTACTAGAGTACGAGCTCCGAACCGCA
AACAAGAAAAAGGAACCCCGTACAGAAGTGGAAGCGATTAACCGAGAATGTCTCGACCACTTCCGTATCTACTTC
CCATCAGACCAGACCGTTCGAGCCGTGCACAGCAATCCCAAATATTCTATCGGCACGATATGCCTCAATCCAGCC
TGGTGGTCGGGTGCCAATTTCCCGCGGGACAAAGTTCGAGACTGTGTGAGCGAGCGCGGAGTCTTGATGCATAAC
AAGGTGAGTACTTCCGCGGTGCCAGACTAGTATATCGATTTTTTACTAATACACAATCCTTCCGACATATAGATT
GCCTTTGTCCACCCTTCCACCCCGATCGATATGCCCGATAAGAAGGAGTGCCGGGGGTGGGCTTATGTGGGGAGT
GCGAATTTGTCAGAGAGTGCATGGTGCGTACATATCTATACTCCACTCGCTGTAATGGCAAAACTAACATGAACC
AGGGGTCGTATCGTCAAGGATACCAAGACGAAACAGCTGAAGATAAGCTGTCGCAACTGGGAATGCGGTGTTATC
GTGCCCATCATCAATGAGAAGAAGACTGGGGAGAAAGATAAGGGACCGGAAACGCATGGGACCGCCCCTTCGGCT
TCTCTCCCAGTCGAGATCTTTACGGATACCGTTCCAGTTCCGATTAAAGTGCCCGCTGTTCCATTATCCGAGCAC
AGGAAGCCTTTCTTCTTTGGAGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail