Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7021.t1
Gene name
Locationscaffold_20:247578..249444
Strand+
Gene length (bp)1866
Transcript length (bp)1644
Coding sequence length (bp)1644
Protein length (aa) 548

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 163 185 22
3 218 240 22
4 281 299 18
5 304 326 22
6 346 368 22
7 412 434 22
8 454 476 22
9 502 524 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 32.90 18.77 47.04
5d_25C Five days - 25 degrees Celsius 37.35 21.47 53.23
7d_25C Seven days - 25 degrees Celsius 31.30 17.33 45.27
10d_25C Ten days - 25 degrees Celsius 21.73 11.43 32.03
7d_15C Seven days - 15 degrees Celsius 27.91 14.87 40.96
7d_30C Seven days - 30 degrees Celsius 65.74 37.64 93.85

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.680695 no
3d_25C 7d_25C 0.895142 no
3d_25C 7d_15C 0.594633 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.090345 no
5d_25C 7d_25C 0.553069 no
5d_25C 7d_15C 0.284407 no
5d_25C 7d_30C 0.009446 yes
5d_25C 10d_25C 0.025611 yes
7d_25C 7d_15C 0.739684 no
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.161166 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.393956 no
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7021.t1
MSCNFDCSAPTPLSPNSDITGIGIIINNIVTTGIAVVIISIYHFTAYDPIHDLSHDGQTPFRPNPVDVSSLALFK
SYLSPFVKIARSKRFANVLIKCIRAMSDMQIMTGFFLLISGYSQLKCGLATYHWLVVVDQAWLSCLVQLSCLTHL
RSYFHNRPIERTLRLLAAGVSTIMLIVGLSFTGNYDWAFHADSSDPDHPTISDPAICYMRARPAMNSAFFSMPFS
IILIIFGFASRVIILYDTLSVSVVRARTSLAGHIRGLLRIVYNWSRASRSPRSLKLTLGYLPLLAIYLTGSVFVD
VWDSAAIEVVWLIIAFAFGITRVIGIIHRPEKMGLDASLTSFNDWSFGQVGAMVVLAAPLITLIGLFYEEDETRV
QDEEPLSDSQTAPPPELPAPSISNVTTDLNDPFKDWISHSQIFYLVDGHIFTMIISVFFWMAERDPFGKIKKTLL
EDILVSSGIKMVVPILFSLMVETIFAEAGPTSISYNLAQVVVKLHSLSCLTFFSVSSSTKITYCLLPILVIWALA
HRFYPFFQALFSSKLLAFLRLS*
Coding >Pro_DTO377G3_2|g7021.t1
ATGTCGTGCAATTTTGACTGCTCGGCTCCCACCCCCTTATCCCCAAACAGCGATATCACTGGGATTGGGATCATT
ATCAACAATATCGTGACTACCGGCATCGCTGTAGTGATCATTTCAATTTACCACTTCACTGCCTACGATCCCATC
CACGACCTGTCTCATGATGGTCAAACTCCGTTTCGACCCAACCCAGTGGACGTATCCTCTTTAGCATTGTTCAAA
TCATACCTAAGCCCTTTCGTCAAAATTGCTAGGAGCAAAAGATTTGCGAATGTCCTAATCAAGTGCATCCGAGCA
ATGAGCGATATGCAAATCATGACAGGCTTTTTCCTCCTGATCAGCGGGTATTCCCAGCTCAAATGCGGCTTGGCA
ACCTATCATTGGCTAGTCGTTGTTGACCAGGCCTGGCTTTCCTGCCTAGTCCAGTTATCCTGCTTAACGCACCTA
CGCAGTTATTTCCACAACCGCCCTATCGAGCGGACATTACGGTTACTAGCAGCCGGTGTATCTACGATAATGTTG
ATCGTGGGGCTTAGTTTCACGGGAAACTACGATTGGGCCTTTCACGCAGATAGTAGCGATCCTGATCACCCGACG
ATTAGTGACCCTGCAATCTGTTATATGCGCGCTCGTCCGGCGATGAATTCGGCCTTTTTTTCGATGCCTTTCTCG
ATAATTTTGATTATCTTTGGATTTGCTTCGAGGGTGATTATCCTCTACGATACGCTTTCAGTTAGCGTTGTTAGA
GCTAGAACTTCCCTTGCAGGACATATACGAGGGTTATTACGCATTGTGTATAACTGGAGCCGGGCGTCTCGCTCG
CCACGAAGTCTGAAATTGACACTTGGATATCTCCCCCTCTTAGCTATATACCTCACGGGGTCTGTGTTTGTGGAT
GTGTGGGATTCCGCTGCTATAGAGGTCGTCTGGTTAATCATCGCCTTTGCATTCGGTATCACCCGAGTGATAGGA
ATAATACATCGACCGGAAAAGATGGGCCTCGACGCTTCGTTGACTAGTTTCAATGATTGGTCGTTTGGCCAAGTT
GGTGCTATGGTGGTACTAGCCGCACCGCTTATCACACTCATCGGGTTGTTCTACGAGGAAGACGAGACTCGTGTA
CAGGATGAGGAACCTCTCTCCGACAGCCAAACCGCACCACCGCCGGAACTCCCTGCCCCTTCTATATCAAACGTA
ACCACGGACCTCAATGATCCCTTTAAGGATTGGATCTCGCACTCCCAAATATTCTATCTGGTCGACGGACATATA
TTCACAATGATCATAAGTGTTTTCTTCTGGATGGCAGAGCGTGATCCTTTCGGCAAGATAAAGAAGACATTATTA
GAGGATATTCTCGTCTCCTCGGGTATCAAGATGGTTGTACCCATTCTTTTCTCTTTGATGGTGGAGACTATCTTT
GCGGAAGCTGGCCCTACTAGTATTTCTTACAACCTTGCGCAAGTTGTAGTAAAGCTGCACAGCCTGAGCTGCCTG
ACGTTTTTCAGTGTCTCCAGTTCTACGAAGATTACTTATTGTCTCCTGCCTATCCTTGTTATCTGGGCTTTGGCG
CATCGCTTCTATCCCTTTTTTCAAGCTTTATTCTCGTCGAAGTTGCTGGCCTTTCTGCGGTTGTCATGA
Transcript >Pro_DTO377G3_2|g7021.t1
ATGTCGTGCAATTTTGACTGCTCGGCTCCCACCCCCTTATCCCCAAACAGCGATATCACTGGGATTGGGATCATT
ATCAACAATATCGTGACTACCGGCATCGCTGTAGTGATCATTTCAATTTACCACTTCACTGCCTACGATCCCATC
CACGACCTGTCTCATGATGGTCAAACTCCGTTTCGACCCAACCCAGTGGACGTATCCTCTTTAGCATTGTTCAAA
TCATACCTAAGCCCTTTCGTCAAAATTGCTAGGAGCAAAAGATTTGCGAATGTCCTAATCAAGTGCATCCGAGCA
ATGAGCGATATGCAAATCATGACAGGCTTTTTCCTCCTGATCAGCGGGTATTCCCAGCTCAAATGCGGCTTGGCA
ACCTATCATTGGCTAGTCGTTGTTGACCAGGCCTGGCTTTCCTGCCTAGTCCAGTTATCCTGCTTAACGCACCTA
CGCAGTTATTTCCACAACCGCCCTATCGAGCGGACATTACGGTTACTAGCAGCCGGTGTATCTACGATAATGTTG
ATCGTGGGGCTTAGTTTCACGGGAAACTACGATTGGGCCTTTCACGCAGATAGTAGCGATCCTGATCACCCGACG
ATTAGTGACCCTGCAATCTGTTATATGCGCGCTCGTCCGGCGATGAATTCGGCCTTTTTTTCGATGCCTTTCTCG
ATAATTTTGATTATCTTTGGATTTGCTTCGAGGGTGATTATCCTCTACGATACGCTTTCAGTTAGCGTTGTTAGA
GCTAGAACTTCCCTTGCAGGACATATACGAGGGTTATTACGCATTGTGTATAACTGGAGCCGGGCGTCTCGCTCG
CCACGAAGTCTGAAATTGACACTTGGATATCTCCCCCTCTTAGCTATATACCTCACGGGGTCTGTGTTTGTGGAT
GTGTGGGATTCCGCTGCTATAGAGGTCGTCTGGTTAATCATCGCCTTTGCATTCGGTATCACCCGAGTGATAGGA
ATAATACATCGACCGGAAAAGATGGGCCTCGACGCTTCGTTGACTAGTTTCAATGATTGGTCGTTTGGCCAAGTT
GGTGCTATGGTGGTACTAGCCGCACCGCTTATCACACTCATCGGGTTGTTCTACGAGGAAGACGAGACTCGTGTA
CAGGATGAGGAACCTCTCTCCGACAGCCAAACCGCACCACCGCCGGAACTCCCTGCCCCTTCTATATCAAACGTA
ACCACGGACCTCAATGATCCCTTTAAGGATTGGATCTCGCACTCCCAAATATTCTATCTGGTCGACGGACATATA
TTCACAATGATCATAAGTGTTTTCTTCTGGATGGCAGAGCGTGATCCTTTCGGCAAGATAAAGAAGACATTATTA
GAGGATATTCTCGTCTCCTCGGGTATCAAGATGGTTGTACCCATTCTTTTCTCTTTGATGGTGGAGACTATCTTT
GCGGAAGCTGGCCCTACTAGTATTTCTTACAACCTTGCGCAAGTTGTAGTAAAGCTGCACAGCCTGAGCTGCCTG
ACGTTTTTCAGTGTCTCCAGTTCTACGAAGATTACTTATTGTCTCCTGCCTATCCTTGTTATCTGGGCTTTGGCG
CATCGCTTCTATCCCTTTTTTCAAGCTTTATTCTCGTCGAAGTTGCTGGCCTTTCTGCGGTTGTCATGA
Gene >Pro_DTO377G3_2|g7021.t1
ATGTCGTGCAATTTTGACTGCTCGGCTCCCACCCCCTTATCCCCAAACAGCGATATCACTGGGATTGGGGTATGA
GTTTCCCTTTCTCTCGGCCGCGGACGCATCTCACACTCTTAGATCATTATCAACAATATCGTGACTACCGGCATC
GCTGTAGTGATCATTTCAATTTACCACTTCACTGCCTACGATCCCATCCACGACCTGTCTCATGATGGTCAAACT
CCGTTTCGACCCAACCCAGTGGACGTATCCTCTTTAGCATTGTTCAAATCATACCTAAGCCCTTTCGTCAAAATT
GCTAGGAGCAAAAGATTTGCGAATGTCCTAATCAAGGTGGGTGGATTCTTATGAGATCGGATCGGTGAATCATCA
AAGTAACTTCGAAAAACAGTGCATCCGAGCAATGAGCGATATGCAAATCATGACAGGCTTTTTCCTCCTGATCAG
CGGGTATTCCCAGCTCAAATGCGGCTTGGCAACCTATCATTGGCTAGTCGTTGTTGACCAGGCCTGGCTTTCCTG
CCTAGTCCAGTTATCCTGCTTAACGCACCTACGCAGTTATTTCCACAACCGCCCTATCGAGCGGACATTACGGTT
ACTAGCAGCCGGTGTATCTACGATAATGTTGATCGTGGGGCTTAGTTTCACGGGAAACTACGATTGGGCCTTTCA
CGCAGATAGTAGCGATCCTGATCACCCGACGATTAGTGACCCTGCAATCTGTTATATGCGCGCTCGTCCGGCGAT
GAATTCGGCCTTTTTTTCGATGCCTTTCTCGATAATTTTGATTATCTTTGGATTTGCTTCGAGGGTGATTATCCT
CTACGATACGCTTTCAGTTAGCGTTGTTAGAGCTAGAACTTCCCTTGCAGGACATATACGAGGGTTATTACGCAT
TGTGTATAACTGGAGCCGGGCGTCTCGCTCGCCACGAAGTCTGAAATTGACACTTGGATATCTCCCCCTCTTAGC
TATATACCTCACGGGGTCTGTGTTTGTGGATGTGTGGGATTCCGCTGCTATAGAGGTCAGATATTATCTATGGGA
CGTGTGTTGATTGTATTCTATGTTCTCTAACTCGATACTAGGTCGTCTGGTTAATCATCGCCTTTGCATTCGGTA
TCACCCGAGTGATAGGAATAATACATCGACCGGAAAAGATGGGCCTCGACGCTTCGTTGACTAGTTTCAATGATT
GGTCGTTTGGCCAAGTTGGTGCTATGGTGGTACTAGCCGCACCGCTTATCACACTCATCGGGTTGTTCTACGAGG
GTGAGTCAAACCATGATTATCGTCTAGAATCAACTGAGATCTAACACTCGTGTAGAAGACGAGACTCGTGTACAG
GATGAGGAACCTCTCTCCGACAGCCAAACCGCACCACCGCCGGAACTCCCTGCCCCTTCTATATCAAACGTAACC
ACGGACCTCAATGATCCCTTTAAGGATTGGATCTCGCACTCCCAAATATTCTATCTGGTCGACGGACATATATTC
ACAATGATCATAAGTGTTTTCTTCTGGATGGCAGAGCGTGATCCTTTCGGCAAGATAAAGAAGACATTATTAGAG
GATATTCTCGTCTCCTCGGGTATCAAGATGGTTGTACCCATTCTTTTCTCTTTGATGGTGGAGACTATCTTTGCG
GAAGCTGGCCCTACTAGTATTTCTTACAACCTTGCGCAAGTTGTAGTAAAGCTGCACAGCCTGAGCTGCCTGACG
TTTTTCAGTGTCTCCAGTTCTACGAAGATTACTTATTGTCTCCTGCCTATCCTTGTTATCTGGGCTTTGGCGCAT
CGCTTCTATCCCTTTTTTCAAGCTTTATTCTCGTCGAAGTTGCTGGCCTTTCTGCGGTTGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail