Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7021.t1
Gene name
Locationscaffold_20:247578..249444
Strand+
Gene length (bp)1866
Transcript length (bp)1644
Coding sequence length (bp)1644
Protein length (aa) 548

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 163 185 22
3 218 240 22
4 281 299 18
5 304 326 22
6 346 368 22
7 412 434 22
8 454 476 22
9 502 524 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7021.t1
MSCNFDCSAPTPLSPNSDITGIGIIINNIVTTGIAVVIISIYHFTAYDPIHDLSHDGQTPFRPNPVDVSSLALFK
SYLSPFVKIARSKRFANVLIKCIRAMSDMQIMTGFFLLISGYSQLKCGLATYHWLVVVDQAWLSCLVQLSCLTHL
RSYFHNRPIERTLRLLAAGVSTIMLIVGLSFTGNYDWAFHADSSDPDHPTISDPAICYMRARPAMNSAFFSMPFS
IILIIFGFASRVIILYDTLSVSVVRARTSLAGHIRGLLRIVYNWSRASRSPRSLKLTLGYLPLLAIYLTGSVFVD
VWDSAAIEVVWLIIAFAFGITRVIGIIHRPEKMGLDASLTSFNDWSFGQVGAMVVLAAPLITLIGLFYEEDETRV
QDEEPLSDSQTAPPPELPAPSISNVTTDLNDPFKDWISHSQIFYLVDGHIFTMIISVFFWMAERDPFGKIKKTLL
EDILVSSGIKMVVPILFSLMVETIFAEAGPTSISYNLAQVVVKLHSLSCLTFFSVSSSTKITYCLLPILVIWALA
HRFYPFFQALFSSKLLAFLRLS*
Coding >Pro_DTO377G3_2|g7021.t1
ATGTCGTGCAATTTTGACTGCTCGGCTCCCACCCCCTTATCCCCAAACAGCGATATCACTGGGATTGGGATCATT
ATCAACAATATCGTGACTACCGGCATCGCTGTAGTGATCATTTCAATTTACCACTTCACTGCCTACGATCCCATC
CACGACCTGTCTCATGATGGTCAAACTCCGTTTCGACCCAACCCAGTGGACGTATCCTCTTTAGCATTGTTCAAA
TCATACCTAAGCCCTTTCGTCAAAATTGCTAGGAGCAAAAGATTTGCGAATGTCCTAATCAAGTGCATCCGAGCA
ATGAGCGATATGCAAATCATGACAGGCTTTTTCCTCCTGATCAGCGGGTATTCCCAGCTCAAATGCGGCTTGGCA
ACCTATCATTGGCTAGTCGTTGTTGACCAGGCCTGGCTTTCCTGCCTAGTCCAGTTATCCTGCTTAACGCACCTA
CGCAGTTATTTCCACAACCGCCCTATCGAGCGGACATTACGGTTACTAGCAGCCGGTGTATCTACGATAATGTTG
ATCGTGGGGCTTAGTTTCACGGGAAACTACGATTGGGCCTTTCACGCAGATAGTAGCGATCCTGATCACCCGACG
ATTAGTGACCCTGCAATCTGTTATATGCGCGCTCGTCCGGCGATGAATTCGGCCTTTTTTTCGATGCCTTTCTCG
ATAATTTTGATTATCTTTGGATTTGCTTCGAGGGTGATTATCCTCTACGATACGCTTTCAGTTAGCGTTGTTAGA
GCTAGAACTTCCCTTGCAGGACATATACGAGGGTTATTACGCATTGTGTATAACTGGAGCCGGGCGTCTCGCTCG
CCACGAAGTCTGAAATTGACACTTGGATATCTCCCCCTCTTAGCTATATACCTCACGGGGTCTGTGTTTGTGGAT
GTGTGGGATTCCGCTGCTATAGAGGTCGTCTGGTTAATCATCGCCTTTGCATTCGGTATCACCCGAGTGATAGGA
ATAATACATCGACCGGAAAAGATGGGCCTCGACGCTTCGTTGACTAGTTTCAATGATTGGTCGTTTGGCCAAGTT
GGTGCTATGGTGGTACTAGCCGCACCGCTTATCACACTCATCGGGTTGTTCTACGAGGAAGACGAGACTCGTGTA
CAGGATGAGGAACCTCTCTCCGACAGCCAAACCGCACCACCGCCGGAACTCCCTGCCCCTTCTATATCAAACGTA
ACCACGGACCTCAATGATCCCTTTAAGGATTGGATCTCGCACTCCCAAATATTCTATCTGGTCGACGGACATATA
TTCACAATGATCATAAGTGTTTTCTTCTGGATGGCAGAGCGTGATCCTTTCGGCAAGATAAAGAAGACATTATTA
GAGGATATTCTCGTCTCCTCGGGTATCAAGATGGTTGTACCCATTCTTTTCTCTTTGATGGTGGAGACTATCTTT
GCGGAAGCTGGCCCTACTAGTATTTCTTACAACCTTGCGCAAGTTGTAGTAAAGCTGCACAGCCTGAGCTGCCTG
ACGTTTTTCAGTGTCTCCAGTTCTACGAAGATTACTTATTGTCTCCTGCCTATCCTTGTTATCTGGGCTTTGGCG
CATCGCTTCTATCCCTTTTTTCAAGCTTTATTCTCGTCGAAGTTGCTGGCCTTTCTGCGGTTGTCATGA
Transcript >Pro_DTO377G3_2|g7021.t1
ATGTCGTGCAATTTTGACTGCTCGGCTCCCACCCCCTTATCCCCAAACAGCGATATCACTGGGATTGGGATCATT
ATCAACAATATCGTGACTACCGGCATCGCTGTAGTGATCATTTCAATTTACCACTTCACTGCCTACGATCCCATC
CACGACCTGTCTCATGATGGTCAAACTCCGTTTCGACCCAACCCAGTGGACGTATCCTCTTTAGCATTGTTCAAA
TCATACCTAAGCCCTTTCGTCAAAATTGCTAGGAGCAAAAGATTTGCGAATGTCCTAATCAAGTGCATCCGAGCA
ATGAGCGATATGCAAATCATGACAGGCTTTTTCCTCCTGATCAGCGGGTATTCCCAGCTCAAATGCGGCTTGGCA
ACCTATCATTGGCTAGTCGTTGTTGACCAGGCCTGGCTTTCCTGCCTAGTCCAGTTATCCTGCTTAACGCACCTA
CGCAGTTATTTCCACAACCGCCCTATCGAGCGGACATTACGGTTACTAGCAGCCGGTGTATCTACGATAATGTTG
ATCGTGGGGCTTAGTTTCACGGGAAACTACGATTGGGCCTTTCACGCAGATAGTAGCGATCCTGATCACCCGACG
ATTAGTGACCCTGCAATCTGTTATATGCGCGCTCGTCCGGCGATGAATTCGGCCTTTTTTTCGATGCCTTTCTCG
ATAATTTTGATTATCTTTGGATTTGCTTCGAGGGTGATTATCCTCTACGATACGCTTTCAGTTAGCGTTGTTAGA
GCTAGAACTTCCCTTGCAGGACATATACGAGGGTTATTACGCATTGTGTATAACTGGAGCCGGGCGTCTCGCTCG
CCACGAAGTCTGAAATTGACACTTGGATATCTCCCCCTCTTAGCTATATACCTCACGGGGTCTGTGTTTGTGGAT
GTGTGGGATTCCGCTGCTATAGAGGTCGTCTGGTTAATCATCGCCTTTGCATTCGGTATCACCCGAGTGATAGGA
ATAATACATCGACCGGAAAAGATGGGCCTCGACGCTTCGTTGACTAGTTTCAATGATTGGTCGTTTGGCCAAGTT
GGTGCTATGGTGGTACTAGCCGCACCGCTTATCACACTCATCGGGTTGTTCTACGAGGAAGACGAGACTCGTGTA
CAGGATGAGGAACCTCTCTCCGACAGCCAAACCGCACCACCGCCGGAACTCCCTGCCCCTTCTATATCAAACGTA
ACCACGGACCTCAATGATCCCTTTAAGGATTGGATCTCGCACTCCCAAATATTCTATCTGGTCGACGGACATATA
TTCACAATGATCATAAGTGTTTTCTTCTGGATGGCAGAGCGTGATCCTTTCGGCAAGATAAAGAAGACATTATTA
GAGGATATTCTCGTCTCCTCGGGTATCAAGATGGTTGTACCCATTCTTTTCTCTTTGATGGTGGAGACTATCTTT
GCGGAAGCTGGCCCTACTAGTATTTCTTACAACCTTGCGCAAGTTGTAGTAAAGCTGCACAGCCTGAGCTGCCTG
ACGTTTTTCAGTGTCTCCAGTTCTACGAAGATTACTTATTGTCTCCTGCCTATCCTTGTTATCTGGGCTTTGGCG
CATCGCTTCTATCCCTTTTTTCAAGCTTTATTCTCGTCGAAGTTGCTGGCCTTTCTGCGGTTGTCATGA
Gene >Pro_DTO377G3_2|g7021.t1
ATGTCGTGCAATTTTGACTGCTCGGCTCCCACCCCCTTATCCCCAAACAGCGATATCACTGGGATTGGGGTATGA
GTTTCCCTTTCTCTCGGCCGCGGACGCATCTCACACTCTTAGATCATTATCAACAATATCGTGACTACCGGCATC
GCTGTAGTGATCATTTCAATTTACCACTTCACTGCCTACGATCCCATCCACGACCTGTCTCATGATGGTCAAACT
CCGTTTCGACCCAACCCAGTGGACGTATCCTCTTTAGCATTGTTCAAATCATACCTAAGCCCTTTCGTCAAAATT
GCTAGGAGCAAAAGATTTGCGAATGTCCTAATCAAGGTGGGTGGATTCTTATGAGATCGGATCGGTGAATCATCA
AAGTAACTTCGAAAAACAGTGCATCCGAGCAATGAGCGATATGCAAATCATGACAGGCTTTTTCCTCCTGATCAG
CGGGTATTCCCAGCTCAAATGCGGCTTGGCAACCTATCATTGGCTAGTCGTTGTTGACCAGGCCTGGCTTTCCTG
CCTAGTCCAGTTATCCTGCTTAACGCACCTACGCAGTTATTTCCACAACCGCCCTATCGAGCGGACATTACGGTT
ACTAGCAGCCGGTGTATCTACGATAATGTTGATCGTGGGGCTTAGTTTCACGGGAAACTACGATTGGGCCTTTCA
CGCAGATAGTAGCGATCCTGATCACCCGACGATTAGTGACCCTGCAATCTGTTATATGCGCGCTCGTCCGGCGAT
GAATTCGGCCTTTTTTTCGATGCCTTTCTCGATAATTTTGATTATCTTTGGATTTGCTTCGAGGGTGATTATCCT
CTACGATACGCTTTCAGTTAGCGTTGTTAGAGCTAGAACTTCCCTTGCAGGACATATACGAGGGTTATTACGCAT
TGTGTATAACTGGAGCCGGGCGTCTCGCTCGCCACGAAGTCTGAAATTGACACTTGGATATCTCCCCCTCTTAGC
TATATACCTCACGGGGTCTGTGTTTGTGGATGTGTGGGATTCCGCTGCTATAGAGGTCAGATATTATCTATGGGA
CGTGTGTTGATTGTATTCTATGTTCTCTAACTCGATACTAGGTCGTCTGGTTAATCATCGCCTTTGCATTCGGTA
TCACCCGAGTGATAGGAATAATACATCGACCGGAAAAGATGGGCCTCGACGCTTCGTTGACTAGTTTCAATGATT
GGTCGTTTGGCCAAGTTGGTGCTATGGTGGTACTAGCCGCACCGCTTATCACACTCATCGGGTTGTTCTACGAGG
GTGAGTCAAACCATGATTATCGTCTAGAATCAACTGAGATCTAACACTCGTGTAGAAGACGAGACTCGTGTACAG
GATGAGGAACCTCTCTCCGACAGCCAAACCGCACCACCGCCGGAACTCCCTGCCCCTTCTATATCAAACGTAACC
ACGGACCTCAATGATCCCTTTAAGGATTGGATCTCGCACTCCCAAATATTCTATCTGGTCGACGGACATATATTC
ACAATGATCATAAGTGTTTTCTTCTGGATGGCAGAGCGTGATCCTTTCGGCAAGATAAAGAAGACATTATTAGAG
GATATTCTCGTCTCCTCGGGTATCAAGATGGTTGTACCCATTCTTTTCTCTTTGATGGTGGAGACTATCTTTGCG
GAAGCTGGCCCTACTAGTATTTCTTACAACCTTGCGCAAGTTGTAGTAAAGCTGCACAGCCTGAGCTGCCTGACG
TTTTTCAGTGTCTCCAGTTCTACGAAGATTACTTATTGTCTCCTGCCTATCCTTGTTATCTGGGCTTTGGCGCAT
CGCTTCTATCCCTTTTTTCAAGCTTTATTCTCGTCGAAGTTGCTGGCCTTTCTGCGGTTGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail