Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7014.t1
Gene name
Locationscaffold_20:226026..226464
Strand-
Gene length (bp)438
Transcript length (bp)369
Coding sequence length (bp)369
Protein length (aa) 123

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11779 SPT_ssu-like Small subunit of serine palmitoyltransferase-like 9.3E-22 14 64

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 93.13 40.86 145.39
5d_25C Five days - 25 degrees Celsius 84.36 35.20 133.53
7d_25C Seven days - 25 degrees Celsius 114.00 53.05 174.95
10d_25C Ten days - 25 degrees Celsius 86.64 37.17 136.12
7d_15C Seven days - 15 degrees Celsius 135.85 65.61 206.09
7d_30C Seven days - 30 degrees Celsius 77.82 32.18 123.47

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.825338 no
3d_25C 7d_25C 0.591182 no
3d_25C 7d_15C 0.239688 no
3d_25C 7d_30C 0.656451 no
3d_25C 10d_25C 0.874953 no
5d_25C 7d_25C 0.386854 no
5d_25C 7d_15C 0.127885 no
5d_25C 7d_30C 0.865224 no
5d_25C 10d_25C 0.957750 no
7d_25C 7d_15C 0.641334 no
7d_25C 7d_30C 0.247399 no
7d_25C 10d_25C 0.433052 no
7d_15C 7d_30C 0.069248 no
7d_15C 10d_25C 0.144613 no
7d_30C 10d_25C 0.807307 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7014.t1
MVDFIIWAVASLFRWMRLKIYQYEVTFSLYMLTPIEKLIFNTLLLGLIAMIAMGTYIYLPDHLLAIYGRLYYYWA
GERLFSSGRLSISSVFGENGVATQIGDLMYETAKNAAATSTERLADL*
Coding >Pro_DTO377G3_2|g7014.t1
ATGGTGGACTTCATTATCTGGGCCGTGGCTAGCCTCTTCCGCTGGATGCGGTTGAAGATCTACCAGTATGAGGTG
ACCTTCTCCCTCTACATGCTTACTCCGATCGAGAAGCTCATCTTCAACACGCTGCTCCTTGGCCTCATTGCCATG
ATAGCCATGGGCACTTACATTTACCTTCCCGACCACCTTCTCGCCATTTACGGGCGCCTTTACTACTACTGGGCC
GGCGAGCGCCTGTTCAGCTCCGGTCGGTTGTCAATCAGTTCGGTCTTTGGCGAAAATGGCGTGGCCACGCAAATC
GGGGATTTGATGTACGAGACGGCAAAGAACGCTGCTGCCACCTCGACCGAGCGCTTGGCTGACCTTTGA
Transcript >Pro_DTO377G3_2|g7014.t1
ATGGTGGACTTCATTATCTGGGCCGTGGCTAGCCTCTTCCGCTGGATGCGGTTGAAGATCTACCAGTATGAGGTG
ACCTTCTCCCTCTACATGCTTACTCCGATCGAGAAGCTCATCTTCAACACGCTGCTCCTTGGCCTCATTGCCATG
ATAGCCATGGGCACTTACATTTACCTTCCCGACCACCTTCTCGCCATTTACGGGCGCCTTTACTACTACTGGGCC
GGCGAGCGCCTGTTCAGCTCCGGTCGGTTGTCAATCAGTTCGGTCTTTGGCGAAAATGGCGTGGCCACGCAAATC
GGGGATTTGATGTACGAGACGGCAAAGAACGCTGCTGCCACCTCGACCGAGCGCTTGGCTGACCTTTGA
Gene >Pro_DTO377G3_2|g7014.t1
ATGGTGGACTTCATTATCTGGGCCGTGGCTAGCCTCTTCCGCTGGATGCGGTTGAAGATCTACCAGTATGAGGTG
ACCTTCTCCCTCTACATGCTTACTCCGATCGAGAAGCTCATCTTCAGTATGTTGCGCCTGTTCCCCGTTCACAAT
ACTCTTGGTACACCATGCTGACCTTTCGTTTCCTATTTAGACACGCTGCTCCTTGGCCTCATTGCCATGATAGCC
ATGGGCACTTACATTTACCTTCCCGACCACCTTCTCGCCATTTACGGGCGCCTTTACTACTACTGGGCCGGCGAG
CGCCTGTTCAGCTCCGGTCGGTTGTCAATCAGTTCGGTCTTTGGCGAAAATGGCGTGGCCACGCAAATCGGGGAT
TTGATGTACGAGACGGCAAAGAACGCTGCTGCCACCTCGACCGAGCGCTTGGCTGACCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail