Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7013.t1
Gene name
Locationscaffold_20:224954..225358
Strand+
Gene length (bp)404
Transcript length (bp)315
Coding sequence length (bp)315
Protein length (aa) 105

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09803 Pet100 Pet100 1.0E-19 10 84

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0033617 mitochondrial cytochrome c oxidase assembly Yes
GO:0016043 cellular component organization No
GO:0022607 cellular component assembly No
GO:0071840 cellular component organization or biogenesis No
GO:0110165 cellular anatomical entity No
GO:0065003 protein-containing complex assembly No
GO:0043226 organelle No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0008535 respiratory chain complex IV assembly No
GO:0043231 intracellular membrane-bounded organelle No
GO:0033108 mitochondrial respiratory chain complex assembly No
GO:0009987 cellular process No
GO:0043227 membrane-bounded organelle No
GO:0017004 cytochrome complex assembly No
GO:0043933 protein-containing complex organization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 13 32 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7013.t1
MSQIFRKLQGGNLEVFKFGMYVLFPIGWMYYFGTNLDDRFATKNFWPTADQSHKIPLDKDEIDQELARMRMVDAV
KREQRRAAEAQAQAQLEAQAQAQTMQTQQ*
Coding >Pro_DTO377G3_2|g7013.t1
ATGTCGCAAATATTCCGCAAGTTGCAGGGAGGCAACCTCGAAGTCTTCAAGTTTGGGATGTACGTCCTCTTCCCG
ATCGGCTGGATGTACTATTTCGGTACCAACCTCGACGACCGCTTCGCCACGAAGAACTTCTGGCCCACTGCCGAT
CAATCGCACAAGATCCCGCTAGACAAGGACGAGATTGACCAGGAATTGGCACGTATGCGCATGGTGGATGCCGTG
AAGCGGGAGCAGAGACGGGCGGCGGAGGCACAGGCTCAAGCGCAATTAGAGGCACAGGCACAGGCACAGACGATG
CAGACTCAGCAATGA
Transcript >Pro_DTO377G3_2|g7013.t1
ATGTCGCAAATATTCCGCAAGTTGCAGGGAGGCAACCTCGAAGTCTTCAAGTTTGGGATGTACGTCCTCTTCCCG
ATCGGCTGGATGTACTATTTCGGTACCAACCTCGACGACCGCTTCGCCACGAAGAACTTCTGGCCCACTGCCGAT
CAATCGCACAAGATCCCGCTAGACAAGGACGAGATTGACCAGGAATTGGCACGTATGCGCATGGTGGATGCCGTG
AAGCGGGAGCAGAGACGGGCGGCGGAGGCACAGGCTCAAGCGCAATTAGAGGCACAGGCACAGGCACAGACGATG
CAGACTCAGCAATGA
Gene >Pro_DTO377G3_2|g7013.t1
ATGTCGCAAATATTCCGCAAGTTGCAGGGAGGCAACCTCGAAGTCTTCAAGGTGCGTATCTGACACTCAAGTCCT
CTGAGCGATTATTCCCACCTACCGCCTCCCACCGCCTCTTCTTAGGACTAACCGAGTCCATGTAGTTTGGGATGT
ACGTCCTCTTCCCGATCGGCTGGATGTACTATTTCGGTACCAACCTCGACGACCGCTTCGCCACGAAGAACTTCT
GGCCCACTGCCGATCAATCGCACAAGATCCCGCTAGACAAGGACGAGATTGACCAGGAATTGGCACGTATGCGCA
TGGTGGATGCCGTGAAGCGGGAGCAGAGACGGGCGGCGGAGGCACAGGCTCAAGCGCAATTAGAGGCACAGGCAC
AGGCACAGACGATGCAGACTCAGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail