Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7008.t1
Gene name
Locationscaffold_20:208093..209534
Strand-
Gene length (bp)1441
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07798 CCDC90-like Coiled-coil domain-containing protein 90-like 1.3E-42 235 406

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 393 412 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 41.71 24.14 59.29
5d_25C Five days - 25 degrees Celsius 38.88 22.24 55.53
7d_25C Seven days - 25 degrees Celsius 40.19 22.99 57.40
10d_25C Ten days - 25 degrees Celsius 42.80 24.81 60.78
7d_15C Seven days - 15 degrees Celsius 42.48 24.59 60.38
7d_30C Seven days - 30 degrees Celsius 32.51 17.94 47.07

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.832735 no
3d_25C 7d_25C 0.918431 no
3d_25C 7d_15C 0.960781 no
3d_25C 7d_30C 0.355997 no
3d_25C 10d_25C 0.943766 no
5d_25C 7d_25C 0.927931 no
5d_25C 7d_15C 0.783524 no
5d_25C 7d_30C 0.539713 no
5d_25C 10d_25C 0.764379 no
7d_25C 7d_15C 0.874006 no
7d_25C 7d_30C 0.455801 no
7d_25C 10d_25C 0.857569 no
7d_15C 7d_30C 0.310937 no
7d_15C 10d_25C 0.984553 no
7d_30C 10d_25C 0.293682 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7008.t1
MATPRLPFLYPNFMRAVRSCEPRTYRSIRIPYRLNQRFHTSQQQERASYQRRYGPAVEPNTAHSLRPKKGPHDQE
VPGDPSAGHDGVNASDQGQAPPDESQSEPPPQEAEQNNADVTSSETPTADQRNADQPTEAETKEDKEDKEDNPPT
DREPREEQAKDIDGAEQEQASASSSPASEAPSEESTDTSSSTNQTPFEDVLHMPSPSVFLTPTGEPSSSDDRPPH
LSAAPYVHPFDTYSLVQDLSKGGYSEEQSTTIMKAVRAILQNNLSLARASLTSKSDVENEEYLFKAACSELQSSL
QTARNSEIQHQRSSRTQLQHETDIISQRLSQELSGMKDDIKGMFNDHKMSTREPQRTIDTSVQELNYKITVSLNS
DGKSEIEGLRWILTRRAASTIAICAFMIIVFLKYASVHKAPEPKQAKQAEKPAASKEIATEARAVQDGGIQTVFP
SAEAHLGESLG*
Coding >Pro_DTO377G3_2|g7008.t1
ATGGCCACACCCAGGCTCCCGTTCCTGTATCCGAATTTTATGCGCGCGGTGCGATCATGCGAACCGAGAACATAC
CGTTCAATTAGAATTCCATACCGGCTTAACCAACGCTTCCATACGAGTCAGCAACAGGAGCGTGCTTCCTACCAG
CGGCGATATGGTCCTGCCGTCGAACCGAATACTGCTCATTCGTTGCGTCCGAAGAAGGGTCCACACGATCAGGAG
GTGCCGGGCGATCCATCAGCTGGACATGATGGTGTAAATGCCTCCGACCAGGGGCAAGCTCCACCAGACGAGTCA
CAGTCGGAACCGCCGCCCCAGGAAGCCGAGCAAAACAATGCAGATGTCACTTCTTCGGAAACCCCGACCGCAGAC
CAACGGAACGCAGACCAACCAACCGAAGCTGAAACAAAGGAAGACAAGGAAGACAAGGAAGACAACCCTCCGACG
GACCGGGAACCGCGCGAGGAGCAGGCCAAAGATATAGACGGCGCCGAACAGGAACAGGCTTCGGCCTCTTCGTCC
CCCGCTTCCGAAGCCCCATCGGAAGAAAGTACAGATACCTCTTCATCCACAAACCAAACTCCGTTTGAGGATGTC
CTCCACATGCCCTCGCCGTCGGTGTTTCTAACCCCAACCGGGGAACCCTCCTCGTCCGACGATCGCCCGCCGCAT
TTGTCTGCAGCACCGTATGTTCACCCTTTCGACACATATTCATTGGTACAGGATCTGTCCAAAGGTGGCTACAGC
GAAGAACAGTCTACTACAATCATGAAGGCTGTGCGGGCTATCCTGCAGAACAACCTCTCTTTGGCTAGGGCGAGC
CTTACTTCGAAATCTGATGTCGAAAATGAAGAATACCTGTTCAAAGCAGCCTGCTCCGAGCTTCAGTCATCGCTC
CAGACAGCTCGCAACTCGGAAATACAGCACCAGCGCTCCTCGCGCACGCAATTGCAGCATGAAACGGATATTATC
TCGCAGCGTCTCAGCCAGGAACTTTCAGGCATGAAAGACGACATCAAGGGCATGTTCAATGACCACAAGATGTCC
ACGCGAGAACCGCAGCGGACCATCGACACCTCGGTTCAGGAATTGAACTACAAGATCACCGTGTCGCTTAACAGC
GATGGAAAGAGTGAGATTGAAGGTCTTCGATGGATTTTGACTAGACGCGCTGCTTCGACGATTGCCATCTGTGCT
TTCATGATCATCGTCTTCTTGAAGTATGCTTCCGTGCACAAGGCGCCTGAGCCCAAGCAAGCCAAGCAAGCGGAG
AAGCCGGCTGCCAGCAAAGAAATCGCTACTGAAGCTCGAGCCGTCCAAGATGGTGGCATTCAGACAGTCTTTCCG
TCTGCTGAAGCCCATCTCGGCGAATCACTTGGTTGA
Transcript >Pro_DTO377G3_2|g7008.t1
ATGGCCACACCCAGGCTCCCGTTCCTGTATCCGAATTTTATGCGCGCGGTGCGATCATGCGAACCGAGAACATAC
CGTTCAATTAGAATTCCATACCGGCTTAACCAACGCTTCCATACGAGTCAGCAACAGGAGCGTGCTTCCTACCAG
CGGCGATATGGTCCTGCCGTCGAACCGAATACTGCTCATTCGTTGCGTCCGAAGAAGGGTCCACACGATCAGGAG
GTGCCGGGCGATCCATCAGCTGGACATGATGGTGTAAATGCCTCCGACCAGGGGCAAGCTCCACCAGACGAGTCA
CAGTCGGAACCGCCGCCCCAGGAAGCCGAGCAAAACAATGCAGATGTCACTTCTTCGGAAACCCCGACCGCAGAC
CAACGGAACGCAGACCAACCAACCGAAGCTGAAACAAAGGAAGACAAGGAAGACAAGGAAGACAACCCTCCGACG
GACCGGGAACCGCGCGAGGAGCAGGCCAAAGATATAGACGGCGCCGAACAGGAACAGGCTTCGGCCTCTTCGTCC
CCCGCTTCCGAAGCCCCATCGGAAGAAAGTACAGATACCTCTTCATCCACAAACCAAACTCCGTTTGAGGATGTC
CTCCACATGCCCTCGCCGTCGGTGTTTCTAACCCCAACCGGGGAACCCTCCTCGTCCGACGATCGCCCGCCGCAT
TTGTCTGCAGCACCGTATGTTCACCCTTTCGACACATATTCATTGGTACAGGATCTGTCCAAAGGTGGCTACAGC
GAAGAACAGTCTACTACAATCATGAAGGCTGTGCGGGCTATCCTGCAGAACAACCTCTCTTTGGCTAGGGCGAGC
CTTACTTCGAAATCTGATGTCGAAAATGAAGAATACCTGTTCAAAGCAGCCTGCTCCGAGCTTCAGTCATCGCTC
CAGACAGCTCGCAACTCGGAAATACAGCACCAGCGCTCCTCGCGCACGCAATTGCAGCATGAAACGGATATTATC
TCGCAGCGTCTCAGCCAGGAACTTTCAGGCATGAAAGACGACATCAAGGGCATGTTCAATGACCACAAGATGTCC
ACGCGAGAACCGCAGCGGACCATCGACACCTCGGTTCAGGAATTGAACTACAAGATCACCGTGTCGCTTAACAGC
GATGGAAAGAGTGAGATTGAAGGTCTTCGATGGATTTTGACTAGACGCGCTGCTTCGACGATTGCCATCTGTGCT
TTCATGATCATCGTCTTCTTGAAGTATGCTTCCGTGCACAAGGCGCCTGAGCCCAAGCAAGCCAAGCAAGCGGAG
AAGCCGGCTGCCAGCAAAGAAATCGCTACTGAAGCTCGAGCCGTCCAAGATGGTGGCATTCAGACAGTCTTTCCG
TCTGCTGAAGCCCATCTCGGCGAATCACTTGGTTGA
Gene >Pro_DTO377G3_2|g7008.t1
ATGGCCACACCCAGGCTCCCGTTCCTGTATCCGAATTTTATGCGCGCGGTGCGATCATGCGAACCGAGAACATAC
CGTTCAATTAGAATTCCATACCGGCTTAACCAACGCTTCCATACGAGTCAGCAACAGGAGCGTGCTTCCTACCAG
CGGCGATATGGTCCTGCCGTCGAACCGAATACTGCTCATTCGTTGCGTCCGAAGAAGGGTCCACACGATCAGGAG
GTGCCGGGCGATCCATCAGCTGGACATGATGGTGTAAATGCCTCCGACCAGGGGCAAGCTCCACCAGACGAGTCA
CAGTCGGAACCGCCGCCCCAGGAAGCCGAGCAAAACAATGCAGATGTCACTTCTTCGGAAACCCCGACCGCAGAC
CAACGGAACGCAGACCAACCAACCGAAGCTGAAACAAAGGAAGACAAGGAAGACAAGGAAGACAACCCTCCGACG
GACCGGGAACCGCGCGAGGAGCAGGCCAAAGATATAGACGGCGCCGAACAGGAACAGGCTTCGGCCTCTTCGTCC
CCCGCTTCCGAAGCCCCATCGGAAGAAAGTACAGATACCTCTTCATCCACAAACCAAACTCCGTTTGAGGATGTC
CTCCACATGCCCTCGCCGTCGGTGTTTCTAACCCCAACCGGGGAACCCTCCTCGTCCGACGATCGCCCGCCGCAT
TTGTCTGCAGCACCGTATGTTCACCCTTTCGACACATATTCATTGGTACAGGATCTGTCCAAAGGTGGCTACAGC
GAAGAACAGTCTACTACAATCATGAAGGCTGTGCGGGCTATCCTGCAGAACAACCTCTCTTTGGCTAGGGCGAGC
CTTACTTCGAAATCTGATGTCGAAAATGAAGAATACCTGTTCAAAGCAGCCTGCTCCGAGCTTCAGTCATCGCTC
CAGACAGCTCGCAACTCGGAAATACAGCACCAGCGCTCCTCGCGCACGCAATTGCAGCATGAAACGGATATTATC
TCGCAGCGTCTCAGCCAGGAACTTTCAGGCATGAAAGACGACATCAAGGGCATGTTCAATGACCACAAGATGTCC
ACGCGAGAACCGCAGCGGACCATCGACACCTCGGTTCAGGAATTGAACTACAAGATCACCGTGTCGCTTAACAGC
GATGGAAAGAGTGAGATTGAAGGTCTTCGATGGATTTTGACTAGACGCGCTGCTTCGACGATTGCCATCTGTGCT
TGTAAGTGCCCCATTGTTCCTATTTGGCTCTTTCGTGTAGCTAACTCGATTATAAGTCATGATCATCGTCTTCTT
GAAGTATGCTTCCGTGCACAAGGCGCCTGAGCCCAAGCAAGCCAAGCAAGCGGAGAAGCCGGCTGCCAGCAAAGA
AATCGCTACTGAAGCTCGAGCCGTCCAAGATGGTGGCATTCAGACAGTCTTTCCGTCTGCTGAAGCCCATCTCGG
CGAATCACTTGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail