Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g70.t1
Gene name
Locationscaffold_01:174740..181598
Strand-
Gene length (bp)6858
Transcript length (bp)5691
Coding sequence length (bp)5691
Protein length (aa) 1897

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03770 IPK Inositol polyphosphate kinase 5.2E-59 1037 1248
PF07690 MFS_1 Major Facilitator Superfamily 3.2E-20 1377 1833
PF06813 Nodulin-like Nodulin-like 6.6E-07 1380 1571

GO

GO Term Description Terminal node
GO:0032958 inositol phosphate biosynthetic process Yes
GO:0055085 transmembrane transport Yes
GO:0016301 kinase activity Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008152 metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0051234 establishment of localization No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0006066 alcohol metabolic process No
GO:0006810 transport No
GO:0019751 polyol metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0003824 catalytic activity No
GO:1901576 organic substance biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0046165 alcohol biosynthetic process No
GO:0009058 biosynthetic process No
GO:0003674 molecular_function No
GO:0043647 inositol phosphate metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0046173 polyol biosynthetic process No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:1901615 organic hydroxy compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 1368 1390 22
2 1434 1453 19
3 1468 1490 22
4 1503 1520 17
5 1546 1568 22
6 1758 1780 22
7 1790 1812 22
8 1819 1841 22
9 1864 1886 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g70.t1
MSNSPSVPEDTLPSPLVTPATPAQHDCSNIIGGGPRHHLPQAHLSRGSGEVLSPSRAESPTAHSWSQPVSRIFPL
KRTATTPPENTAQPDIVYRPQLSERDSIFATHYLPSDSAATTPQLPPEKALGNERQVNLIPSLDDASVSPSAFSK
VSPHRYSVDPSRMEVDVHRTSPLRSSTLFSSTDLPRLSLLRTPTSPTGRSKKTEVETGAPPHLAGSQRYKVPWDN
TGTKTSRFQGTLPERKLFPSALDDVSTSHSLTIPTSGHEGSQISQDPLSYSAKEEKPQTPVVLERSPSRGRRGRV
DSSIEANFTNPEPASNVRSRKSSHYLGLFKENTASSPDRKRREDRGRPQDETLESRDRIMEHEQESYRSEHETSL
HKSTSLSALGDAPSFQPPPAELSQSTYDDDPSKRGPTALPRSLLEEIRNFHLTPGGSHGSSFSRSIPTQYSERAR
DYFQSDLHAEVSPSNSFEEEERGQVEEEENEQISSAVYFPHERTVPDGVEGLQQFPDSPLHVQPGQLSAAEKGHE
LMLVPQERSDSPKKEISHVDISFRSKNESKILYGDIHSQRENVPEKPLSTISECSDSIYDSEVEPQSADESIPSA
DEVETPSATPTQPSRLLSRPKPPPPGPLGAVELKPYRHQVGGHTTVFRFSRRAVCKQLNNRENEFYERIELRHPD
MLVFLPKYIGVLNVTFSKTSKRKDQVDSADKIIPDPTANGTSTPSSEPPESAKQQPPQRIVSQSQVTGVIPKVIL
ENNRHIIPADLFTRQQRPRTADASMSRARSVDGLKGMSAESDTSPMSKRAKIWGATTVNLKLQEQVLREVFSPPA
IHHHRRHARGHVHLPRANSDMPGATHRRENLSEDCTATNQRPVPSPVAALKTEAIDIKVTPSEGSALSSSASTAL
EANQNRLEKIRTEEPDRASSLSRVHHPRRRHSGSGLRRRGTMDSNNNGELMFFDDDDYGGDKEDGIFSMEADASM
SNGSSTVPVSENNSTNGGHATEAAFGRTSDPTRFKPQEPINTILPSNPKEAQLRKDERVQFFLLLEDLTAGMNKP
CVLDLKMGTRQYGIEANEKKKKSQRRKCQSTTSQQLGVRLCGMQSWNVKKQEYMFEDKYFGRDLKSGREFQDALT
RFLYDGVSYASVAKKIPVILEKLALLEHMIRQLSSYRLYASSLLILYDGEPQSPPQQEPPRSNNGNHADGQSKLN
VQLKIVDFANCITGEDKLPPDTPCPPHSPHDIDRGYLRGLRTLRMYFQRIMKEVSLDEFVERGEGEAIALGSQPE
ARERPSSQYWDETMIETDAGERDFDANRPLLQNIDAEQDTTDRNAEPSWRYSRRGSRSSGNDGLSDDGLLSDVVE
EIVERDRRRMQKEVIRVLSFGWGVVTCLGAGSITAFSLYGHLLLTRLHYSQLQVNAVSIAAEIAMYLPVPLFGYL
CDRYSPSPLAMFSGLVFGVGYLLAAFTYKSGPPADAGGSGQPFWVMIVAFIAIGMGTSCMYLAAIATCAKNFGRG
KHKGIMLAVPIAAFGLSGMWQSQLGTYLFYEPLEDGSHGDLDVYKYFVFLAVLLLVIGIIGTFALRIVDDDDKYI
DETVEELERSGLLEESDFFRPQAIEYGTFSDSSDEEQSILSDEEREQQRLEKEREEEERRKRNWLLNYETRVFLQ
DKTMWWLAAGFFLVTGPGESYINNLGTIIPTLTPQSYPTGASPPAGSPSTHVTTIALTSTIARLLTGSLSDFFAP
PATHLFPSISEGARYAPLTSPASSRLTLSRMTFLVPSAFLLSLGYLLLASPLPLAHPGIFNLTTALIGFGYGSAF
SLAPIIISVVWGVENFATNWGIVAMMPAAGAALWGIIYSAAYQNAMDRGDGDGADGQCHGWRCYGFWAAGCTVSV
WVAVLAWVAAWRGWKRRGVVV*
Coding >Pro_DTO377G3_2|g70.t1
ATGTCAAACTCGCCGTCCGTTCCCGAAGATACCTTGCCTAGTCCCCTGGTGACACCTGCTACACCGGCCCAACAT
GATTGCTCCAATATCATCGGGGGTGGCCCACGTCACCATTTGCCGCAAGCTCATTTGTCTCGGGGCTCTGGGGAG
GTTTTATCACCGTCGCGCGCGGAATCCCCCACCGCCCATTCCTGGTCTCAGCCCGTCTCCCGAATATTCCCTCTA
AAAAGAACCGCTACCACACCTCCGGAGAACACCGCGCAGCCTGATATTGTCTACAGGCCTCAACTGTCCGAACGT
GACAGTATCTTCGCTACTCATTACCTCCCCTCTGATAGTGCCGCCACTACCCCACAACTCCCCCCCGAAAAGGCC
TTGGGCAATGAACGCCAGGTCAACTTGATCCCTAGCCTTGACGATGCATCCGTGTCTCCAAGTGCATTCTCCAAG
GTCTCTCCCCATCGTTATAGCGTCGACCCTTCCCGCATGGAAGTTGACGTCCACAGAACCTCTCCGTTGCGTTCC
TCGACCCTCTTCTCATCCACCGACCTCCCTCGTTTGTCTCTGCTGCGCACACCGACCTCGCCGACTGGTCGCTCA
AAGAAAACCGAGGTCGAGACGGGTGCGCCGCCTCATTTGGCCGGATCCCAGCGATACAAGGTGCCATGGGATAAC
ACAGGTACGAAGACCAGTCGGTTCCAAGGCACTTTACCTGAGCGGAAATTGTTCCCGTCTGCATTAGATGATGTC
TCTACCTCTCACTCTTTGACTATCCCAACCTCTGGCCACGAGGGCTCTCAGATCAGTCAGGATCCCTTATCCTAC
AGTGCGAAAGAAGAAAAACCTCAGACCCCTGTGGTGCTTGAGCGAAGCCCCAGCAGAGGTCGTCGTGGCCGAGTT
GACAGCTCGATCGAGGCCAATTTTACCAACCCGGAGCCGGCCTCTAACGTGCGCAGTCGTAAGTCTAGCCACTAC
CTGGGCCTTTTCAAAGAAAACACTGCTTCTTCACCGGATCGCAAACGACGGGAGGATCGCGGCCGACCACAAGAT
GAGACGTTGGAGTCGAGGGATCGCATCATGGAACATGAACAAGAATCATATCGCTCAGAGCACGAAACGTCGCTT
CATAAAAGCACATCACTCTCCGCACTTGGCGATGCCCCGTCTTTCCAACCTCCCCCGGCTGAATTATCTCAGTCC
ACATACGATGATGACCCCTCCAAGCGTGGCCCTACAGCCTTGCCTCGCAGCTTGCTAGAGGAGATCCGAAACTTT
CATCTCACGCCTGGTGGTAGCCATGGGTCTTCTTTCTCAAGAAGCATTCCCACTCAATATTCAGAGCGCGCCCGT
GACTACTTCCAGAGCGATCTTCATGCCGAGGTATCCCCGTCTAACTCTTTCGAGGAAGAGGAGCGTGGTCAGGTT
GAGGAGGAAGAAAACGAGCAGATTTCTTCTGCCGTTTACTTCCCCCACGAGCGTACGGTTCCTGATGGGGTTGAG
GGCCTGCAACAATTTCCCGATAGCCCTCTTCATGTACAGCCGGGTCAGCTGTCGGCTGCGGAGAAAGGTCATGAG
CTGATGTTAGTACCTCAAGAGCGTAGCGATTCTCCCAAAAAGGAAATCAGCCATGTGGATATATCCTTTCGATCT
AAGAATGAAAGTAAGATCCTTTATGGCGATATCCATTCTCAACGAGAGAATGTGCCAGAAAAGCCTTTGAGTACC
ATCTCTGAATGCAGCGATTCAATCTACGATTCCGAAGTCGAACCCCAATCGGCAGATGAAAGTATCCCATCTGCT
GACGAGGTGGAAACCCCGAGTGCCACACCCACCCAGCCTTCTCGGCTTCTCTCTCGTCCCAAACCCCCGCCCCCG
GGGCCTCTTGGTGCCGTGGAATTGAAGCCCTATCGACATCAGGTTGGCGGGCACACAACTGTTTTCCGCTTTTCC
AGACGCGCTGTATGCAAGCAGTTGAACAACCGAGAGAACGAGTTCTACGAACGCATTGAACTGAGGCACCCAGAT
ATGTTGGTATTTCTTCCCAAGTACATCGGAGTGTTGAATGTCACCTTTTCGAAGACATCCAAACGAAAGGACCAG
GTCGATTCTGCCGATAAAATAATTCCAGATCCGACAGCCAATGGAACTTCAACGCCCAGCTCTGAGCCTCCAGAG
TCAGCAAAGCAACAACCGCCACAGCGAATTGTTAGCCAGTCCCAAGTCACAGGAGTCATCCCCAAGGTCATTCTT
GAGAACAATCGCCATATAATTCCTGCCGATCTTTTTACTCGTCAGCAGCGACCGCGGACAGCAGATGCTTCAATG
AGCCGCGCACGATCCGTTGACGGTCTGAAAGGTATGTCAGCGGAGTCTGATACATCGCCTATGAGTAAGCGGGCC
AAGATCTGGGGCGCCACGACCGTCAATCTCAAGCTTCAGGAGCAGGTTCTCCGCGAGGTATTCAGCCCTCCTGCC
ATTCATCATCATCGTCGACATGCTCGTGGTCATGTCCATTTGCCAAGAGCTAATTCCGATATGCCGGGCGCCACG
CACCGTCGAGAGAATCTATCAGAAGACTGCACAGCTACCAATCAACGACCAGTCCCTAGCCCAGTCGCGGCGCTA
AAGACAGAAGCGATTGACATAAAGGTGACTCCTAGTGAAGGCTCTGCTCTTTCATCGTCGGCTTCGACTGCCCTA
GAAGCCAATCAAAACCGTCTAGAGAAGATCCGGACCGAAGAGCCTGACCGAGCAAGCTCGCTCTCTCGGGTTCAC
CACCCAAGACGGCGTCATTCCGGGAGTGGCCTTCGGAGACGTGGTACCATGGACTCTAACAACAATGGGGAACTC
ATGTTCTTCGATGACGATGATTATGGCGGTGACAAGGAGGATGGGATTTTCTCCATGGAAGCCGATGCCTCAATG
TCGAATGGTTCCTCCACGGTCCCAGTGTCGGAAAATAACTCGACCAATGGTGGCCACGCAACCGAAGCTGCTTTC
GGTAGAACTTCTGATCCAACGCGCTTCAAACCACAGGAGCCTATCAACACGATCTTGCCCAGCAACCCCAAAGAG
GCGCAGCTGAGAAAGGACGAAAGAGTGCAGTTCTTCCTCCTCCTTGAGGATCTGACAGCTGGTATGAATAAACCA
TGCGTGCTGGATTTGAAGATGGGCACCCGTCAATATGGTATCGAGGCGAATGAGAAGAAGAAGAAGTCTCAGCGA
CGGAAATGTCAGTCCACTACTTCGCAGCAGCTGGGTGTGCGGCTCTGTGGCATGCAGTCCTGGAACGTCAAGAAG
CAGGAGTACATGTTTGAAGACAAGTATTTCGGGCGAGATTTGAAGTCTGGTCGTGAATTTCAGGATGCGCTGACT
CGATTCCTATACGATGGTGTCAGCTATGCCAGTGTTGCCAAAAAGATCCCTGTCATTCTGGAGAAATTAGCTTTG
TTAGAGCACATGATTCGACAGTTGAGTAGCTACCGGCTCTATGCTAGCAGTCTGTTGATTCTTTATGACGGAGAA
CCACAATCTCCACCTCAGCAAGAACCGCCGCGTTCTAATAATGGAAACCATGCAGACGGCCAGAGCAAACTGAAC
GTTCAACTGAAGATTGTCGATTTCGCTAATTGCATCACTGGCGAGGACAAGCTTCCTCCGGATACGCCATGCCCA
CCTCACAGCCCGCACGACATTGATCGTGGATATCTGCGTGGCCTCCGCACACTCCGAATGTATTTCCAGCGAATT
ATGAAGGAGGTCAGTCTGGACGAATTCGTGGAACGAGGTGAAGGTGAAGCCATCGCGCTGGGCTCTCAACCCGAG
GCTCGTGAGCGACCCTCTTCTCAATATTGGGATGAGACCATGATAGAAACCGACGCGGGCGAACGCGATTTCGAC
GCGAATCGCCCACTCCTCCAAAATATTGATGCAGAACAAGATACAACAGACCGAAACGCAGAGCCGTCATGGCGA
TATTCACGGCGAGGTTCACGGAGCTCCGGTAATGACGGACTGAGTGATGACGGGCTGTTGAGCGATGTCGTCGAA
GAGATTGTCGAGCGGGACAGACGGAGGATGCAGAAGGAGGTTATCCGAGTGCTCAGCTTTGGCTGGGGTGTTGTT
ACTTGCTTGGGAGCCGGCAGCATCACTGCTTTCTCTCTGTATGGCCATCTTCTCCTTACTCGACTCCATTACTCG
CAGCTCCAGGTCAATGCCGTTTCCATCGCTGCCGAGATCGCAATGTACCTTCCCGTCCCCTTGTTCGGCTACTTG
TGTGACCGCTACAGCCCATCGCCACTGGCCATGTTCTCGGGACTGGTGTTTGGCGTCGGGTATCTCCTCGCTGCA
TTCACATATAAAAGTGGCCCACCTGCTGATGCGGGTGGTTCCGGTCAGCCATTCTGGGTGATGATCGTGGCGTTT
ATCGCCATTGGTATGGGGACTAGCTGCATGTACCTAGCAGCTATTGCGACGTGCGCCAAGAACTTTGGCAGGGGA
AAGCACAAGGGGATTATGCTTGCTGTTCCGATTGCCGCGTTCGGTCTCAGTGGTATGTGGCAGAGCCAGCTCGGG
ACGTACCTGTTTTATGAACCCCTCGAGGATGGGAGTCACGGCGATCTCGACGTTTATAAATACTTTGTCTTTCTG
GCGGTGCTTTTGCTGGTGATTGGGATCATCGGTACCTTTGCCTTGCGCATCGTGGATGATGATGATAAGTATATT
GATGAGACGGTTGAAGAACTAGAGCGCAGTGGACTGTTAGAGGAGAGTGATTTCTTCCGACCACAAGCGATTGAG
TACGGCACGTTCTCTGATTCATCTGATGAGGAGCAATCAATCCTCTCCGATGAAGAACGTGAGCAGCAAAGGCTA
GAGAAGGAGCGCGAGGAAGAGGAGCGCCGGAAGAGGAACTGGCTGCTCAACTATGAAACCCGTGTATTCCTACAA
GACAAGACCATGTGGTGGCTGGCCGCAGGCTTTTTCTTGGTCACCGGCCCCGGCGAATCGTACATTAACAACCTG
GGCACAATCATCCCAACCCTCACACCTCAATCCTATCCCACAGGCGCATCACCCCCAGCCGGATCCCCCTCAACC
CACGTCACAACCATAGCCCTAACCTCGACCATCGCGCGCCTTCTAACAGGCTCACTTTCCGACTTCTTCGCACCC
CCGGCAACACACCTCTTTCCTTCGATTTCCGAAGGAGCCCGATACGCGCCCCTCACATCCCCTGCATCCTCGCGC
CTCACTCTATCCCGCATGACCTTCCTCGTCCCCTCAGCCTTCCTCCTCTCCCTAGGCTACCTCCTCCTCGCCTCC
CCTCTCCCATTAGCGCACCCAGGCATCTTCAACCTGACAACCGCGCTGATCGGCTTCGGATACGGCAGCGCCTTT
TCCCTCGCGCCTATCATCATCTCTGTCGTCTGGGGCGTCGAGAACTTCGCCACAAATTGGGGTATCGTTGCCATG
ATGCCTGCGGCTGGTGCCGCGCTCTGGGGCATTATCTACTCCGCGGCATATCAAAATGCCATGGATCGCGGCGAC
GGTGATGGTGCTGATGGTCAGTGCCATGGATGGCGATGCTATGGGTTCTGGGCTGCTGGCTGCACGGTTAGTGTG
TGGGTTGCTGTTCTGGCTTGGGTGGCTGCTTGGAGGGGGTGGAAGAGGAGGGGGGTTGTTGTTTAG
Transcript >Pro_DTO377G3_2|g70.t1
ATGTCAAACTCGCCGTCCGTTCCCGAAGATACCTTGCCTAGTCCCCTGGTGACACCTGCTACACCGGCCCAACAT
GATTGCTCCAATATCATCGGGGGTGGCCCACGTCACCATTTGCCGCAAGCTCATTTGTCTCGGGGCTCTGGGGAG
GTTTTATCACCGTCGCGCGCGGAATCCCCCACCGCCCATTCCTGGTCTCAGCCCGTCTCCCGAATATTCCCTCTA
AAAAGAACCGCTACCACACCTCCGGAGAACACCGCGCAGCCTGATATTGTCTACAGGCCTCAACTGTCCGAACGT
GACAGTATCTTCGCTACTCATTACCTCCCCTCTGATAGTGCCGCCACTACCCCACAACTCCCCCCCGAAAAGGCC
TTGGGCAATGAACGCCAGGTCAACTTGATCCCTAGCCTTGACGATGCATCCGTGTCTCCAAGTGCATTCTCCAAG
GTCTCTCCCCATCGTTATAGCGTCGACCCTTCCCGCATGGAAGTTGACGTCCACAGAACCTCTCCGTTGCGTTCC
TCGACCCTCTTCTCATCCACCGACCTCCCTCGTTTGTCTCTGCTGCGCACACCGACCTCGCCGACTGGTCGCTCA
AAGAAAACCGAGGTCGAGACGGGTGCGCCGCCTCATTTGGCCGGATCCCAGCGATACAAGGTGCCATGGGATAAC
ACAGGTACGAAGACCAGTCGGTTCCAAGGCACTTTACCTGAGCGGAAATTGTTCCCGTCTGCATTAGATGATGTC
TCTACCTCTCACTCTTTGACTATCCCAACCTCTGGCCACGAGGGCTCTCAGATCAGTCAGGATCCCTTATCCTAC
AGTGCGAAAGAAGAAAAACCTCAGACCCCTGTGGTGCTTGAGCGAAGCCCCAGCAGAGGTCGTCGTGGCCGAGTT
GACAGCTCGATCGAGGCCAATTTTACCAACCCGGAGCCGGCCTCTAACGTGCGCAGTCGTAAGTCTAGCCACTAC
CTGGGCCTTTTCAAAGAAAACACTGCTTCTTCACCGGATCGCAAACGACGGGAGGATCGCGGCCGACCACAAGAT
GAGACGTTGGAGTCGAGGGATCGCATCATGGAACATGAACAAGAATCATATCGCTCAGAGCACGAAACGTCGCTT
CATAAAAGCACATCACTCTCCGCACTTGGCGATGCCCCGTCTTTCCAACCTCCCCCGGCTGAATTATCTCAGTCC
ACATACGATGATGACCCCTCCAAGCGTGGCCCTACAGCCTTGCCTCGCAGCTTGCTAGAGGAGATCCGAAACTTT
CATCTCACGCCTGGTGGTAGCCATGGGTCTTCTTTCTCAAGAAGCATTCCCACTCAATATTCAGAGCGCGCCCGT
GACTACTTCCAGAGCGATCTTCATGCCGAGGTATCCCCGTCTAACTCTTTCGAGGAAGAGGAGCGTGGTCAGGTT
GAGGAGGAAGAAAACGAGCAGATTTCTTCTGCCGTTTACTTCCCCCACGAGCGTACGGTTCCTGATGGGGTTGAG
GGCCTGCAACAATTTCCCGATAGCCCTCTTCATGTACAGCCGGGTCAGCTGTCGGCTGCGGAGAAAGGTCATGAG
CTGATGTTAGTACCTCAAGAGCGTAGCGATTCTCCCAAAAAGGAAATCAGCCATGTGGATATATCCTTTCGATCT
AAGAATGAAAGTAAGATCCTTTATGGCGATATCCATTCTCAACGAGAGAATGTGCCAGAAAAGCCTTTGAGTACC
ATCTCTGAATGCAGCGATTCAATCTACGATTCCGAAGTCGAACCCCAATCGGCAGATGAAAGTATCCCATCTGCT
GACGAGGTGGAAACCCCGAGTGCCACACCCACCCAGCCTTCTCGGCTTCTCTCTCGTCCCAAACCCCCGCCCCCG
GGGCCTCTTGGTGCCGTGGAATTGAAGCCCTATCGACATCAGGTTGGCGGGCACACAACTGTTTTCCGCTTTTCC
AGACGCGCTGTATGCAAGCAGTTGAACAACCGAGAGAACGAGTTCTACGAACGCATTGAACTGAGGCACCCAGAT
ATGTTGGTATTTCTTCCCAAGTACATCGGAGTGTTGAATGTCACCTTTTCGAAGACATCCAAACGAAAGGACCAG
GTCGATTCTGCCGATAAAATAATTCCAGATCCGACAGCCAATGGAACTTCAACGCCCAGCTCTGAGCCTCCAGAG
TCAGCAAAGCAACAACCGCCACAGCGAATTGTTAGCCAGTCCCAAGTCACAGGAGTCATCCCCAAGGTCATTCTT
GAGAACAATCGCCATATAATTCCTGCCGATCTTTTTACTCGTCAGCAGCGACCGCGGACAGCAGATGCTTCAATG
AGCCGCGCACGATCCGTTGACGGTCTGAAAGGTATGTCAGCGGAGTCTGATACATCGCCTATGAGTAAGCGGGCC
AAGATCTGGGGCGCCACGACCGTCAATCTCAAGCTTCAGGAGCAGGTTCTCCGCGAGGTATTCAGCCCTCCTGCC
ATTCATCATCATCGTCGACATGCTCGTGGTCATGTCCATTTGCCAAGAGCTAATTCCGATATGCCGGGCGCCACG
CACCGTCGAGAGAATCTATCAGAAGACTGCACAGCTACCAATCAACGACCAGTCCCTAGCCCAGTCGCGGCGCTA
AAGACAGAAGCGATTGACATAAAGGTGACTCCTAGTGAAGGCTCTGCTCTTTCATCGTCGGCTTCGACTGCCCTA
GAAGCCAATCAAAACCGTCTAGAGAAGATCCGGACCGAAGAGCCTGACCGAGCAAGCTCGCTCTCTCGGGTTCAC
CACCCAAGACGGCGTCATTCCGGGAGTGGCCTTCGGAGACGTGGTACCATGGACTCTAACAACAATGGGGAACTC
ATGTTCTTCGATGACGATGATTATGGCGGTGACAAGGAGGATGGGATTTTCTCCATGGAAGCCGATGCCTCAATG
TCGAATGGTTCCTCCACGGTCCCAGTGTCGGAAAATAACTCGACCAATGGTGGCCACGCAACCGAAGCTGCTTTC
GGTAGAACTTCTGATCCAACGCGCTTCAAACCACAGGAGCCTATCAACACGATCTTGCCCAGCAACCCCAAAGAG
GCGCAGCTGAGAAAGGACGAAAGAGTGCAGTTCTTCCTCCTCCTTGAGGATCTGACAGCTGGTATGAATAAACCA
TGCGTGCTGGATTTGAAGATGGGCACCCGTCAATATGGTATCGAGGCGAATGAGAAGAAGAAGAAGTCTCAGCGA
CGGAAATGTCAGTCCACTACTTCGCAGCAGCTGGGTGTGCGGCTCTGTGGCATGCAGTCCTGGAACGTCAAGAAG
CAGGAGTACATGTTTGAAGACAAGTATTTCGGGCGAGATTTGAAGTCTGGTCGTGAATTTCAGGATGCGCTGACT
CGATTCCTATACGATGGTGTCAGCTATGCCAGTGTTGCCAAAAAGATCCCTGTCATTCTGGAGAAATTAGCTTTG
TTAGAGCACATGATTCGACAGTTGAGTAGCTACCGGCTCTATGCTAGCAGTCTGTTGATTCTTTATGACGGAGAA
CCACAATCTCCACCTCAGCAAGAACCGCCGCGTTCTAATAATGGAAACCATGCAGACGGCCAGAGCAAACTGAAC
GTTCAACTGAAGATTGTCGATTTCGCTAATTGCATCACTGGCGAGGACAAGCTTCCTCCGGATACGCCATGCCCA
CCTCACAGCCCGCACGACATTGATCGTGGATATCTGCGTGGCCTCCGCACACTCCGAATGTATTTCCAGCGAATT
ATGAAGGAGGTCAGTCTGGACGAATTCGTGGAACGAGGTGAAGGTGAAGCCATCGCGCTGGGCTCTCAACCCGAG
GCTCGTGAGCGACCCTCTTCTCAATATTGGGATGAGACCATGATAGAAACCGACGCGGGCGAACGCGATTTCGAC
GCGAATCGCCCACTCCTCCAAAATATTGATGCAGAACAAGATACAACAGACCGAAACGCAGAGCCGTCATGGCGA
TATTCACGGCGAGGTTCACGGAGCTCCGGTAATGACGGACTGAGTGATGACGGGCTGTTGAGCGATGTCGTCGAA
GAGATTGTCGAGCGGGACAGACGGAGGATGCAGAAGGAGGTTATCCGAGTGCTCAGCTTTGGCTGGGGTGTTGTT
ACTTGCTTGGGAGCCGGCAGCATCACTGCTTTCTCTCTGTATGGCCATCTTCTCCTTACTCGACTCCATTACTCG
CAGCTCCAGGTCAATGCCGTTTCCATCGCTGCCGAGATCGCAATGTACCTTCCCGTCCCCTTGTTCGGCTACTTG
TGTGACCGCTACAGCCCATCGCCACTGGCCATGTTCTCGGGACTGGTGTTTGGCGTCGGGTATCTCCTCGCTGCA
TTCACATATAAAAGTGGCCCACCTGCTGATGCGGGTGGTTCCGGTCAGCCATTCTGGGTGATGATCGTGGCGTTT
ATCGCCATTGGTATGGGGACTAGCTGCATGTACCTAGCAGCTATTGCGACGTGCGCCAAGAACTTTGGCAGGGGA
AAGCACAAGGGGATTATGCTTGCTGTTCCGATTGCCGCGTTCGGTCTCAGTGGTATGTGGCAGAGCCAGCTCGGG
ACGTACCTGTTTTATGAACCCCTCGAGGATGGGAGTCACGGCGATCTCGACGTTTATAAATACTTTGTCTTTCTG
GCGGTGCTTTTGCTGGTGATTGGGATCATCGGTACCTTTGCCTTGCGCATCGTGGATGATGATGATAAGTATATT
GATGAGACGGTTGAAGAACTAGAGCGCAGTGGACTGTTAGAGGAGAGTGATTTCTTCCGACCACAAGCGATTGAG
TACGGCACGTTCTCTGATTCATCTGATGAGGAGCAATCAATCCTCTCCGATGAAGAACGTGAGCAGCAAAGGCTA
GAGAAGGAGCGCGAGGAAGAGGAGCGCCGGAAGAGGAACTGGCTGCTCAACTATGAAACCCGTGTATTCCTACAA
GACAAGACCATGTGGTGGCTGGCCGCAGGCTTTTTCTTGGTCACCGGCCCCGGCGAATCGTACATTAACAACCTG
GGCACAATCATCCCAACCCTCACACCTCAATCCTATCCCACAGGCGCATCACCCCCAGCCGGATCCCCCTCAACC
CACGTCACAACCATAGCCCTAACCTCGACCATCGCGCGCCTTCTAACAGGCTCACTTTCCGACTTCTTCGCACCC
CCGGCAACACACCTCTTTCCTTCGATTTCCGAAGGAGCCCGATACGCGCCCCTCACATCCCCTGCATCCTCGCGC
CTCACTCTATCCCGCATGACCTTCCTCGTCCCCTCAGCCTTCCTCCTCTCCCTAGGCTACCTCCTCCTCGCCTCC
CCTCTCCCATTAGCGCACCCAGGCATCTTCAACCTGACAACCGCGCTGATCGGCTTCGGATACGGCAGCGCCTTT
TCCCTCGCGCCTATCATCATCTCTGTCGTCTGGGGCGTCGAGAACTTCGCCACAAATTGGGGTATCGTTGCCATG
ATGCCTGCGGCTGGTGCCGCGCTCTGGGGCATTATCTACTCCGCGGCATATCAAAATGCCATGGATCGCGGCGAC
GGTGATGGTGCTGATGGTCAGTGCCATGGATGGCGATGCTATGGGTTCTGGGCTGCTGGCTGCACGGTTAGTGTG
TGGGTTGCTGTTCTGGCTTGGGTGGCTGCTTGGAGGGGGTGGAAGAGGAGGGGGGTTGTTGTTTAG
Gene >Pro_DTO377G3_2|g70.t1
ATGTCAAACTCGCCGTCCGTTCCCGAAGATACCTTGCCTAGTCCCCTGGTGACACCTGCTACACCGGCCCAACAT
GATTGCTCCAATATCATCGGGGGTGGCCCACGTCACCATTTGCCGCAAGCTCATTTGTCTCGGGGCTCTGGGGAG
GTTTTATCACCGTCGCGCGCGGAATCCCCCACCGCCCATTCCTGGTCTCAGCCCGTCTCCCGAATATTCCCTCTA
AAAAGAACCGCTACCACACCTCCGGAGAACACCGCGCAGCCTGATATTGTCTACAGGCCTCAACTGTCCGAACGT
GACAGTATCTTCGCTACTCATTACCTCCCCTCTGATAGTGCCGCCACTACCCCACAACTCCCCCCCGAAAAGGCC
TTGGGCAATGAACGCCAGGTCAACTTGATCCCTAGCCTTGACGATGCATCCGTGTCTCCAAGTGCATTCTCCAAG
GTCTCTCCCCATCGTTATAGCGTCGACCCTTCCCGCATGGAAGTTGACGTCCACAGAACCTCTCCGTTGCGTTCC
TCGACCCTCTTCTCATCCACCGACCTCCCTCGTTTGTCTCTGCTGCGCACACCGACCTCGCCGACTGGTCGCTCA
AAGAAAACCGAGGTCGAGACGGGTGCGCCGCCTCATTTGGCCGGATCCCAGCGATACAAGGTGCCATGGGATAAC
ACAGGTACGAAGACCAGTCGGTTCCAAGGCACTTTACCTGAGCGGAAATTGTTCCCGTCTGCATTAGATGATGTC
TCTACCTCTCACTCTTTGACTATCCCAACCTCTGGCCACGAGGGCTCTCAGATCAGTCAGGATCCCTTATCCTAC
AGTGCGAAAGAAGAAAAACCTCAGACCCCTGTGGTGCTTGAGCGAAGCCCCAGCAGAGGTCGTCGTGGCCGAGTT
GACAGCTCGATCGAGGCCAATTTTACCAACCCGGAGCCGGCCTCTAACGTGCGCAGTCGTAAGTCTAGCCACTAC
CTGGGCCTTTTCAAAGAAAACACTGCTTCTTCACCGGATCGCAAACGACGGGAGGATCGCGGCCGACCACAAGAT
GAGACGTTGGAGTCGAGGGATCGCATCATGGAACATGAACAAGAATCATATCGCTCAGAGCACGAAACGTCGCTT
CATAAAAGCACATCACTCTCCGCACTTGGCGATGCCCCGTCTTTCCAACCTCCCCCGGCTGAATTATCTCAGTCC
ACATACGATGATGACCCCTCCAAGCGTGGCCCTACAGCCTTGCCTCGCAGCTTGCTAGAGGAGATCCGAAACTTT
CATCTCACGCCTGGTGGTAGCCATGGGTCTTCTTTCTCAAGAAGCATTCCCACTCAATATTCAGAGCGCGCCCGT
GACTACTTCCAGAGCGATCTTCATGCCGAGGTATCCCCGTCTAACTCTTTCGAGGAAGAGGAGCGTGGTCAGGTT
GAGGAGGAAGAAAACGAGCAGATTTCTTCTGCCGTTTACTTCCCCCACGAGCGTACGGTTCCTGATGGGGTTGAG
GGCCTGCAACAATTTCCCGATAGCCCTCTTCATGTACAGCCGGGTCAGCTGTCGGCTGCGGAGAAAGGTCATGAG
CTGATGTTAGTACCTCAAGAGCGTAGCGATTCTCCCAAAAAGGAAATCAGCCATGTGGATATATCCTTTCGATCT
AAGAATGAAAGTAAGATCCTTTATGGCGATATCCATTCTCAACGAGAGAATGTGCCAGAAAAGCCTTTGAGTACC
ATCTCTGAATGCAGCGATTCAATCTACGATTCCGAAGTCGAACCCCAATCGGCAGATGAAAGTATCCCATCTGCT
GACGAGGTGGAAACCCCGAGTGCCACACCCACCCAGCCTTCTCGGCTTCTCTCTCGTCCCAAACCCCCGCCCCCG
GGGCCTCTTGGTGCCGTGGAATTGAAGCCCTATCGACATCAGGTTGGCGGGCACACAACTGTTTTCCGCTTTTCC
AGACGCGCTGTATGCAAGCAGTTGAACAACCGAGAGAACGAGTTCTACGAACGCATTGAACTGAGGCACCCAGAT
ATGTTGGTATTTCTTCCCAAGTATGTAAAATCAATTCCACGAAGATCAGACGGTTATCAGCATCTTAAATACTAA
TATTTCGATCAGGTACATCGGAGTGTTGAATGTCACCTTTTCGAAGACATCCAAACGAAAGGACCAGGTCGATTC
TGCCGATAAAATAATTCCAGATCCGACAGCCAATGGAACTTCAACGCCCAGCTCTGAGCCTCCAGAGTCAGCAAA
GCAACAACCGCCACAGCGAATTGTTAGCCAGTCCCAAGTCACAGGAGTCATCCCCAAGGTCATTCTTGAGAACAA
TCGCCATATAATTCCTGCCGATCTTTTTACTCGTCAGCAGCGACCGCGGACAGCAGATGCTTCAATGAGCCGCGC
ACGATCCGTTGACGGTCTGAAAGGTATGTCAGCGGAGTCTGATACATCGCCTATGAGTAAGCGGGCCAAGATCTG
GGGCGCCACGACCGTCAATCTCAAGCTTCAGGAGCAGGTTCTCCGCGAGGTATTCAGCCCTCCTGCCATTCATCA
TCATCGTCGACATGCTCGTGGTCATGTCCATTTGCCAAGAGCTAATTCCGATATGCCGGGCGCCACGCACCGTCG
AGAGAATCTATCAGAAGACTGCACAGCTACCAATCAACGACCAGTCCCTAGCCCAGTCGCGGCGCTAAAGACAGA
AGCGATTGACATAAAGGTGACTCCTAGTGAAGGCTCTGCTCTTTCATCGTCGGCTTCGACTGCCCTAGAAGCCAA
TCAAAACCGTCTAGAGAAGATCCGGACCGAAGAGCCTGACCGAGCAAGCTCGCTCTCTCGGGTTCACCACCCAAG
ACGGCGTCATTCCGGGAGTGGCCTTCGGAGACGTGGTACCATGGACTCTAACAACAATGGGGAACTCATGTTCTT
CGATGACGATGATTATGGCGGTGACAAGGAGGATGGGATTTTCTCCATGGAAGCCGATGCCTCAATGTCGAATGG
TTCCTCCACGGTCCCAGTGTCGGAAAATAACTCGACCAATGGTGGCCACGCAACCGAAGCTGCTTTCGGTAGAAC
TTCTGATCCAACGCGCTTCAAACCACAGGAGCCTATCAACACGATCTTGCCCAGCAACCCCAAAGAGGCGCAGCT
GAGAAAGGACGAAAGAGTGCAGTTCTTCCTCCTCCTTGAGGATCTGACAGCTGGTATGAATAAACCATGCGTGCT
GGATTTGAAGATGGGCACCCGTCAATATGGTATCGAGGCGAATGAGAAGAAGAAGAAGTCTCAGCGACGGAAATG
TCAGTCCACTACTTCGCAGCAGCTGGGTGTGCGGCTCTGTGGCATGCAGTCCTGGAACGTCAAGAAGCAGGAGTA
CATGTTTGAAGACAAGTATTTCGGGCGAGATTTGAAGTCTGGTCGTGAATTTCAGGATGCGCTGACTCGATTCCT
ATACGATGGTGTCAGCTATGCCAGTGTTGCCAAAAAGATCCCTGTCATTCTGGAGAAATTAGCTTTGTTAGAGCA
CATGATTCGACAGTTGAGTAGCTACCGGCTCTATGCTAGCAGTCTGTTGATTCTTTATGACGGAGAACCACAATC
TCCACCTCAGCAAGAACCGCCGCGTTCTAATAATGGAAACCATGCAGACGGCCAGAGCAAACTGAACGTTCAACT
GAAGATTGTCGATTTCGCTAATTGCATCACTGGCGAGGACAAGCTTCCTCCGGATACGCCATGCCCACCTCACAG
CCCGCACGACATTGATCGTGGATATCTGCGTGGCCTCCGCACACTCCGAATGTATTTCCAGCGAATTATGAAGGA
GGTCAGTCTGGACGAATTCGTGGAACGAGGTGAAGGTGAAGCCATCGCGCTGGGCTCTCAACCCGAGGCTCGTGA
GCGACCCTCTTCTCAATATTGGGATGAGACCATGATAGAAACCGACGCGGGCGAAGTCAGTTTCTAGCTCCTTTT
CCTTTTCCTTTTTCGCCTTTTGCTTTCTTTTGTTTTTATCATCTCTCGGCCCACTGCCGATACGTGGCGTTCGGA
GGGTAGATCCTTCCACATCGGAACGCCAGCATTCATATGCACCAGTGCCTGATCCCGCCTGATCGTCGGCACTAC
GAAATAACGACCCGGCCCTTCAATGGGTGTTTCTATGATCCCCGTCAACGCTTGGATGCATTTAGAGTCGTTTGC
GGTTTTTATTTTGTCTTTGGCCTTGTTTTTCTTCTCTTCTTTTTGTTTCTCGGAAGCCCTTTTGTCTTGTCTTTT
CTCGGGCGTGTATCAGTTTCTTTTCTTTCTGTTTTATTGATATTGATAATACCCCCCAATGTCTCCAAATCCTTT
TTTTCGGTCTGTCTGTTGTTATCCTATGGTCTTACTTGTACATGAATATCCTTTTTATCTCTAGATGGTGTATTT
CCCTTCGTTTCCACTATATCACAGTATAGGTATTCCTTTACTCCGTACAATGACGTGATCGGGTATTGTAGAATG
AGTCACGTGTAATGACTCCAACTCTCTCCGCTCTCTCCGCTGAAGTCCTCCTCAGCTTGCCTTGACGACTACGCC
TTTTGAGCATCACATATATTACCTATCTACAATTCTACATTGAACATAACTCCCCGGGATCGAAAGCTGAACTCC
AATGACGTAGCATTGAACAACACAACCTCAGGATCCACCCAGCAGACACCGCTCCACCCTTGAAGCTCTATCACA
CGGACAATCGTACTCAGCGTACATATCAGGCCAAATCGTGAACACCATATAGTTCTATCTCAAACGCCTCCCACC
TTCCATACCCATCTATACCACCCATCTTACACTTCCCCTCAGACAAAGAGTCGGTTGCACAGCCTAGCGTAACCG
GTGCGGAGAAGGCACTATGACGATCGATAAGCGCGATTTCGACGCGAATCGCCCACTCCTCCAAAATATTGATGC
AGAACAAGATACAACAGACCGAAACGCAGAGCCGTCATGGCGATATTCACGGCGAGGTTCACGGAGCTCCGGTAA
TGACGGACTGAGTGATGACGGGCTGTTGAGCGATGTCGTCGAAGAGATTGTCGAGCGGGACAGACGGAGGATGCA
GAAGGAGGTTATCCGAGTGCTCAGCTTTGGCTGGGGTGTTGTTACTTGGTATGGGAAACTCTTCTTCCTTGCAGC
CATGCTTACGAGACGATCTATCTCCATTGGGATCCTGGAAGCTGACTCTTATATTCGTGTTTTGCAGCTTGGGAG
CCGGCAGCATCACTGCTTTCTCTCTGTATGGCCATCTTCTCCTTACTCGACTCCATTACTCGCAGCTCCAGGTCA
ATGCCGTTTCCATCGCTGCCGAGATCGCAATGTACCTTCCCGTCCCCTTGTTCGGCTACTTGTGTGACCGCTACA
GCCCATCGCCACTGGCCATGTTCTCGGGACTGGTGTTTGGCGTCGGGTATCTCCTCGCTGCATTCACATATAAAA
GTGGCCCACCTGCTGATGCGGGTGGTTCCGGTCAGCCATTCTGGGTGATGATCGTGGCGTTTATCGCCATTGGTA
TGGGGACTAGCTGCATGTACCTAGCAGCTATTGCGACGTGCGCCAAGAACTTTGGCAGGGGAAAGCACAAGGGGA
TTATGCTTGCTGTTCCGATTGCCGCGTTCGGTCTCAGTGGTATGTGGCAGAGCCAGCTCGGGACGTACCTGTTTT
ATGAACCCCTCGAGGATGGGAGTCACGGCGATCTCGACGTTTATAAATACTTTGTCTTTCTGGCGGTGCTTTTGC
TGGTGATTGGGATCATCGGTACCTTTGCCTTGCGCATCGTGGATGATGATGATAAGTATATTGATGAGACGGTTG
AAGAACTAGAGCGCAGTGGACTGTTAGAGGAGAGTGATTTCTTCCGACCACAAGCGATTGAGTACGGCACGTTCT
CTGATTCATCTGATGAGGAGCAATCAATCCTCTCCGATGAAGAACGTGAGCAGCAAAGGCTAGAGAAGGAGCGCG
AGGAAGAGGAGCGCCGGAAGAGGAACTGGCTGCTCAACTATGAAACCCGTGTATTCCTACAAGACAAGACCATGT
GGTGGCTGGCCGCAGGCTTTTTCTTGGTCACCGGCCCCGGCGAATCGTACATTAACAACGTGAGTTCGTCTCCAA
TCTCACTCCAACCCATAACTAACCTATTAACCAAAATAGCTGGGCACAATCATCCCAACCCTCACACCTCAATCC
TATCCCACAGGCGCATCACCCCCAGCCGGATCCCCCTCAACCCACGTCACAACCATAGCCCTAACCTCGACCATC
GCGCGCCTTCTAACAGGCTCACTTTCCGACTTCTTCGCACCCCCGGCAACACACCTCTTTCCTTCGATTTCCGAA
GGAGCCCGATACGCGCCCCTCACATCCCCTGCATCCTCGCGCCTCACTCTATCCCGCATGACCTTCCTCGTCCCC
TCAGCCTTCCTCCTCTCCCTAGGCTACCTCCTCCTCGCCTCCCCTCTCCCATTAGCGCACCCAGGCATCTTCAAC
CTGACAACCGCGCTGATCGGCTTCGGATACGGCAGCGCCTTTTCCCTCGCGCCTATCATCATCTCTGTCGTCTGG
GGCGTCGAGAACTTCGCCACAAATTGGGGTATCGTTGCCATGATGCCTGCGGCTGGTGCCGCGCTCTGGGGCATT
ATCTACTCCGCGGCATATCAAAATGCCATGGATCGCGGCGACGGTGATGGTGCTGATGGTCAGTGCCATGGATGG
CGATGCTATGGGTTCTGGGCTGCTGGCTGCACGGTTAGTGTGTGGGTTGCTGTTCTGGCTTGGGTGGCTGCTTGG
AGGGGGTGGAAGAGGAGGGGGGTTGTTGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail