Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6995.t1
Gene name
Locationscaffold_20:180328..181508
Strand+
Gene length (bp)1180
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10483 Elong_Iki1 Elongator subunit Iki1 2.6E-101 16 333

GO

GO Term Description Terminal node
GO:0002098 tRNA wobble uridine modification Yes
GO:0033588 elongator holoenzyme complex Yes
GO:0008033 tRNA processing No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006396 RNA processing No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0006399 tRNA metabolic process No
GO:0008152 metabolic process No
GO:0032991 protein-containing complex No
GO:0034470 ncRNA processing No
GO:0009451 RNA modification No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043412 macromolecule modification No
GO:0002097 tRNA wobble base modification No
GO:0006807 nitrogen compound metabolic process No
GO:0140535 intracellular protein-containing complex No
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0006400 tRNA modification No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0034660 ncRNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 32.16 16.43 47.89
5d_25C Five days - 25 degrees Celsius 23.72 11.23 36.21
7d_25C Seven days - 25 degrees Celsius 25.18 12.09 38.28
10d_25C Ten days - 25 degrees Celsius 20.88 9.56 32.19
7d_15C Seven days - 15 degrees Celsius 36.78 19.41 54.15
7d_30C Seven days - 30 degrees Celsius 24.32 11.44 37.21

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.315189 no
3d_25C 7d_25C 0.441154 no
3d_25C 7d_15C 0.701138 no
3d_25C 7d_30C 0.365534 no
3d_25C 10d_25C 0.133060 no
5d_25C 7d_25C 0.889546 no
5d_25C 7d_15C 0.104750 no
5d_25C 7d_30C 0.957296 no
5d_25C 10d_25C 0.746739 no
7d_25C 7d_15C 0.186625 no
7d_25C 7d_30C 0.938888 no
7d_25C 10d_25C 0.606952 no
7d_15C 7d_30C 0.144146 no
7d_15C 10d_25C 0.038184 yes
7d_30C 10d_25C 0.686534 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6995.t1
MAPINLSHRRTHNLLLISKLLSLRDTASPLTLVLDSLEQPATPLLKEYIRRAKLSKVHVTLVAFETLKQPDGVDA
FVSTRRKSPADIVKEVSAVYQPVAASNSSRRRLILIDSINPLLNSKRVDPGFDLPSFLGSIIAPTSPSAKVDVSL
VMTHHQDVPELPQQSPYSPSPISVLTYLATSIITLHSFSHVLAQKAARDRSLAPPVFGLEEEQEGILLGRLDRLA
GTGQAEGIVIELEHRRKSGRGVLEWYLLPPASRYSPQHPKEIVTLLDDNVLYNPPMERDPSAGDEEPTSTFELGL
TDRQRREREGVVLPYFDAQHNDGPGEGGRILYDMGEEDDFDEEEDEI*
Coding >Pro_DTO377G3_2|g6995.t1
ATGGCCCCTATCAATCTTTCACACAGGCGAACGCACAACTTACTCTTGATTTCGAAACTCTTGAGCTTGCGTGAC
ACTGCATCGCCCCTCACGCTTGTCTTAGATTCTTTGGAGCAACCGGCTACGCCACTCCTGAAAGAATATATCAGA
CGTGCAAAGCTATCCAAAGTCCATGTCACACTCGTCGCTTTTGAAACCCTGAAGCAACCGGATGGAGTCGATGCT
TTTGTATCAACACGCCGCAAGAGCCCTGCCGATATAGTTAAAGAAGTGAGCGCAGTTTATCAGCCTGTTGCAGCC
TCCAACTCCTCACGCAGGCGTCTTATCCTCATTGACTCTATTAACCCCCTTCTGAACTCAAAAAGAGTCGACCCT
GGATTTGATTTACCCTCCTTCCTTGGCTCGATTATTGCTCCCACTTCGCCATCGGCCAAGGTTGATGTGTCACTC
GTGATGACACATCATCAAGATGTCCCCGAACTTCCACAGCAAAGTCCCTACTCACCATCTCCTATTTCTGTGTTG
ACATACCTCGCTACGAGCATCATCACACTTCATTCGTTCTCGCACGTTCTAGCACAGAAGGCTGCTCGCGACCGC
AGTCTGGCTCCTCCAGTCTTCGGGCTTGAGGAAGAGCAAGAAGGCATTCTCCTCGGCCGATTGGACAGATTGGCT
GGTACTGGCCAAGCCGAGGGAATTGTTATTGAACTGGAGCACAGGCGGAAGAGTGGCCGTGGTGTACTGGAATGG
TACCTTCTCCCGCCTGCCTCACGGTATTCGCCACAGCATCCGAAAGAGATCGTGACGTTGCTTGACGATAATGTT
CTGTACAATCCTCCTATGGAGCGAGATCCAAGCGCGGGTGATGAGGAACCAACGTCGACCTTTGAGCTGGGTCTC
ACCGACCGACAGAGGCGCGAAAGAGAAGGTGTTGTGTTGCCGTACTTCGACGCACAGCATAACGATGGCCCAGGC
GAAGGAGGTCGGATTCTTTACGACATGGGAGAGGAAGACGATTTCGATGAAGAAGAGGATGAGATTTAG
Transcript >Pro_DTO377G3_2|g6995.t1
ATGGCCCCTATCAATCTTTCACACAGGCGAACGCACAACTTACTCTTGATTTCGAAACTCTTGAGCTTGCGTGAC
ACTGCATCGCCCCTCACGCTTGTCTTAGATTCTTTGGAGCAACCGGCTACGCCACTCCTGAAAGAATATATCAGA
CGTGCAAAGCTATCCAAAGTCCATGTCACACTCGTCGCTTTTGAAACCCTGAAGCAACCGGATGGAGTCGATGCT
TTTGTATCAACACGCCGCAAGAGCCCTGCCGATATAGTTAAAGAAGTGAGCGCAGTTTATCAGCCTGTTGCAGCC
TCCAACTCCTCACGCAGGCGTCTTATCCTCATTGACTCTATTAACCCCCTTCTGAACTCAAAAAGAGTCGACCCT
GGATTTGATTTACCCTCCTTCCTTGGCTCGATTATTGCTCCCACTTCGCCATCGGCCAAGGTTGATGTGTCACTC
GTGATGACACATCATCAAGATGTCCCCGAACTTCCACAGCAAAGTCCCTACTCACCATCTCCTATTTCTGTGTTG
ACATACCTCGCTACGAGCATCATCACACTTCATTCGTTCTCGCACGTTCTAGCACAGAAGGCTGCTCGCGACCGC
AGTCTGGCTCCTCCAGTCTTCGGGCTTGAGGAAGAGCAAGAAGGCATTCTCCTCGGCCGATTGGACAGATTGGCT
GGTACTGGCCAAGCCGAGGGAATTGTTATTGAACTGGAGCACAGGCGGAAGAGTGGCCGTGGTGTACTGGAATGG
TACCTTCTCCCGCCTGCCTCACGGTATTCGCCACAGCATCCGAAAGAGATCGTGACGTTGCTTGACGATAATGTT
CTGTACAATCCTCCTATGGAGCGAGATCCAAGCGCGGGTGATGAGGAACCAACGTCGACCTTTGAGCTGGGTCTC
ACCGACCGACAGAGGCGCGAAAGAGAAGGTGTTGTGTTGCCGTACTTCGACGCACAGCATAACGATGGCCCAGGC
GAAGGAGGTCGGATTCTTTACGACATGGGAGAGGAAGACGATTTCGATGAAGAAGAGGATGAGATTTAG
Gene >Pro_DTO377G3_2|g6995.t1
ATGGCCCCTATCAATCTTTCACACAGGCGAACGCACAACTTACTCTTGATTTCGAAACTCTTGAGCTTGCGTGAC
ACTGCATCGCCCCTCACGCTTGTCTTAGATTCTTTGGAGCAACCGGCTACGCCACTCCTGAAAGAATATATCAGA
CGTGCAAAGGTATATTGGCTGAAAATTATACCACTAGCGACATCTGGCTCACTAGGTACGGGGTGGACAGCCATG
CTGACTAGTTCGACAGCTATCCAAAGTCCATGTCACACTCGTCGCTTTTGAAACCCTGAAGCAACCGGATGGAGT
CGATGCTTTTGTATCAACACGCCGCAAGAGCCCTGCCGATATAGTTAAAGAAGTGAGCGCAGTTTATCAGCCTGT
TGCAGCCTCCAACTCCTCACGCAGTAAGCATTGTGGATTTAACCCCGCTAGTGGACGCATACTTACTGCCCGAGT
AGGGCGTCTTATCCTCATTGACTCTATTAACCCCCTTCTGAACTCAAAAAGAGTCGACCCTGGATTTGATTTACC
CTCCTTCCTTGGCTCGATTATTGCTCCCACTTCGCCATCGGCCAAGGTTGATGTGTCACTCGTGATGACACATCA
TCAAGATGTCCCCGAACTTCCACAGCAAAGTCCCTACTCACCATCTCCTATTTCTGTGTTGACATACCTCGCTAC
GAGCATCATCACACTTCATTCGTTCTCGCACGTTCTAGCACAGAAGGCTGCTCGCGACCGCAGTCTGGCTCCTCC
AGTCTTCGGGCTTGAGGAAGAGCAAGAAGGCATTCTCCTCGGCCGATTGGACAGATTGGCTGGTACTGGCCAAGC
CGAGGGAATTGTTATTGAACTGGAGCACAGGCGGAAGAGTGGCCGTGGTGTACTGGAATGGTACCTTCTCCCGCC
TGCCTCACGGTATTCGCCACAGCATCCGAAAGAGATCGTGACGTTGCTTGACGATAATGTTCTGTACAATCCTCC
TATGGAGCGAGATCCAAGCGCGGGTGATGAGGAACCAACGTCGACCTTTGAGCTGGGTCTCACCGACCGACAGAG
GCGCGAAAGAGAAGGTGTTGTGTTGCCGTACTTCGACGCACAGCATAACGATGGCCCAGGCGAAGGAGGTCGGAT
TCTTTACGACATGGGAGAGGAAGACGATTTCGATGAAGAAGAGGATGAGATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail