Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6991.t1
Gene name
Locationscaffold_20:169292..170593
Strand-
Gene length (bp)1301
Transcript length (bp)1227
Coding sequence length (bp)1227
Protein length (aa) 409

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 2.6E-68 10 387
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 9.8E-05 12 50

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 483.14 278.62 687.67
5d_25C Five days - 25 degrees Celsius 586.08 326.61 845.55
7d_25C Seven days - 25 degrees Celsius 539.98 301.60 778.36
10d_25C Ten days - 25 degrees Celsius 762.33 413.96 1110.70
7d_15C Seven days - 15 degrees Celsius 768.39 397.87 1138.91
7d_30C Seven days - 30 degrees Celsius 479.36 263.47 695.24

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.490474 no
3d_25C 7d_25C 0.721475 no
3d_25C 7d_15C 0.053871 no
3d_25C 7d_30C 0.985232 no
3d_25C 10d_25C 0.051659 no
5d_25C 7d_25C 0.811093 no
5d_25C 7d_15C 0.327971 no
5d_25C 7d_30C 0.479192 no
5d_25C 10d_25C 0.333742 no
7d_25C 7d_15C 0.170122 no
7d_25C 7d_30C 0.711321 no
7d_25C 10d_25C 0.171662 no
7d_15C 7d_30C 0.050897 no
7d_15C 10d_25C 0.984727 no
7d_30C 10d_25C 0.049750 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6991.t1
MSATGDRREIVIVGGGIIGCCSAYYLTRHPSYDPTRHKITLIEACEIAGAASGKAGGMLAQWAFPSNIVGLSYKL
HAELAKEHDGINRWGYREVNCGQLVVRGRALAEHTAGKSGGGDRESLLKRSAAAMSKLKSAKIPQDLDWIEPDLL
RSYENMSGPGETAQVHPYFFTTSIAKLAQDEGASIILGQVTDIDRSKGSVQSVTYTDKTSGETKTITATDVLVAA
GPWTKTILPEVPISGMRAHSVVIQPKKPVSAYCLFTNIEIPADFNPEKKSRPTVAAPEIYARPDDTVYACGDGDR
TVSLPKTSADVQVDQTRCQEIIDHVGSISDELRDGEVRARQACYLPNCETGGGPLIGLTDVKGLYVAAGHTCWGI
QNAPGTGKLMSEFVFDGKAKSANIGSLDPRNFI*
Coding >Pro_DTO377G3_2|g6991.t1
ATGTCAGCAACAGGAGATCGGCGTGAGATTGTTATTGTTGGTGGTGGCATCATTGGATGCTGCTCTGCATATTAC
CTCACAAGACACCCGTCATACGACCCTACCCGTCACAAGATTACACTCATTGAGGCCTGTGAAATCGCCGGCGCT
GCATCAGGCAAAGCGGGTGGCATGCTGGCGCAATGGGCTTTCCCAAGCAACATCGTTGGTCTCAGCTACAAACTG
CATGCCGAACTTGCAAAAGAGCACGATGGTATCAATCGATGGGGATACAGAGAGGTCAATTGTGGCCAACTCGTC
GTGAGAGGTCGTGCTCTTGCCGAGCACACTGCAGGGAAATCCGGGGGTGGAGATAGGGAATCTCTGCTGAAACGC
AGTGCAGCGGCTATGTCGAAGCTGAAGTCTGCCAAAATCCCCCAGGACTTGGATTGGATTGAGCCGGATCTTCTG
CGGTCCTATGAAAATATGAGTGGACCGGGCGAAACTGCTCAAGTGCACCCATACTTCTTCACTACCTCTATTGCA
AAGCTCGCCCAGGACGAGGGCGCAAGTATCATTCTTGGACAGGTTACAGATATTGATCGGTCCAAGGGTTCTGTG
CAGTCAGTGACATACACTGATAAGACATCAGGTGAAACAAAAACCATCACCGCAACCGATGTGCTCGTTGCTGCT
GGTCCCTGGACGAAGACTATCCTCCCAGAGGTCCCCATCTCAGGCATGCGGGCCCACAGCGTGGTGATCCAGCCA
AAGAAACCAGTCAGCGCATACTGCCTGTTTACAAACATCGAAATCCCGGCCGACTTCAACCCCGAAAAGAAGTCA
CGCCCAACTGTGGCTGCGCCAGAGATCTACGCGCGCCCTGATGACACCGTCTATGCATGTGGCGACGGAGATAGA
ACGGTCTCATTACCAAAGACTTCTGCAGATGTCCAGGTTGACCAGACGCGCTGCCAGGAAATCATAGATCATGTG
GGTAGCATTTCTGACGAGCTGCGCGACGGAGAGGTTCGCGCTCGCCAGGCTTGCTATCTTCCTAACTGTGAAACT
GGCGGTGGGCCACTAATTGGCTTGACCGATGTAAAGGGACTGTATGTTGCAGCTGGCCATACCTGCTGGGGTATC
CAGAATGCGCCGGGTACAGGGAAGCTCATGAGTGAGTTTGTATTTGATGGCAAGGCGAAGAGCGCAAACATTGGA
TCGTTGGATCCACGAAACTTCATCTGA
Transcript >Pro_DTO377G3_2|g6991.t1
ATGTCAGCAACAGGAGATCGGCGTGAGATTGTTATTGTTGGTGGTGGCATCATTGGATGCTGCTCTGCATATTAC
CTCACAAGACACCCGTCATACGACCCTACCCGTCACAAGATTACACTCATTGAGGCCTGTGAAATCGCCGGCGCT
GCATCAGGCAAAGCGGGTGGCATGCTGGCGCAATGGGCTTTCCCAAGCAACATCGTTGGTCTCAGCTACAAACTG
CATGCCGAACTTGCAAAAGAGCACGATGGTATCAATCGATGGGGATACAGAGAGGTCAATTGTGGCCAACTCGTC
GTGAGAGGTCGTGCTCTTGCCGAGCACACTGCAGGGAAATCCGGGGGTGGAGATAGGGAATCTCTGCTGAAACGC
AGTGCAGCGGCTATGTCGAAGCTGAAGTCTGCCAAAATCCCCCAGGACTTGGATTGGATTGAGCCGGATCTTCTG
CGGTCCTATGAAAATATGAGTGGACCGGGCGAAACTGCTCAAGTGCACCCATACTTCTTCACTACCTCTATTGCA
AAGCTCGCCCAGGACGAGGGCGCAAGTATCATTCTTGGACAGGTTACAGATATTGATCGGTCCAAGGGTTCTGTG
CAGTCAGTGACATACACTGATAAGACATCAGGTGAAACAAAAACCATCACCGCAACCGATGTGCTCGTTGCTGCT
GGTCCCTGGACGAAGACTATCCTCCCAGAGGTCCCCATCTCAGGCATGCGGGCCCACAGCGTGGTGATCCAGCCA
AAGAAACCAGTCAGCGCATACTGCCTGTTTACAAACATCGAAATCCCGGCCGACTTCAACCCCGAAAAGAAGTCA
CGCCCAACTGTGGCTGCGCCAGAGATCTACGCGCGCCCTGATGACACCGTCTATGCATGTGGCGACGGAGATAGA
ACGGTCTCATTACCAAAGACTTCTGCAGATGTCCAGGTTGACCAGACGCGCTGCCAGGAAATCATAGATCATGTG
GGTAGCATTTCTGACGAGCTGCGCGACGGAGAGGTTCGCGCTCGCCAGGCTTGCTATCTTCCTAACTGTGAAACT
GGCGGTGGGCCACTAATTGGCTTGACCGATGTAAAGGGACTGTATGTTGCAGCTGGCCATACCTGCTGGGGTATC
CAGAATGCGCCGGGTACAGGGAAGCTCATGAGTGAGTTTGTATTTGATGGCAAGGCGAAGAGCGCAAACATTGGA
TCGTTGGATCCACGAAACTTCATCTGA
Gene >Pro_DTO377G3_2|g6991.t1
ATGTCAGCAACAGGAGATCGGCGTGAGATTGTTATTGTTGGTAAGAACATATTGTTTGCGCGACTTTCCTACCCC
GCATGTTTATTCGCAACTTGCTAACCACAATCCTCACAGGTGGTGGCATCATTGGATGCTGCTCTGCATATTACC
TCACAAGACACCCGTCATACGACCCTACCCGTCACAAGATTACACTCATTGAGGCCTGTGAAATCGCCGGCGCTG
CATCAGGCAAAGCGGGTGGCATGCTGGCGCAATGGGCTTTCCCAAGCAACATCGTTGGTCTCAGCTACAAACTGC
ATGCCGAACTTGCAAAAGAGCACGATGGTATCAATCGATGGGGATACAGAGAGGTCAATTGTGGCCAACTCGTCG
TGAGAGGTCGTGCTCTTGCCGAGCACACTGCAGGGAAATCCGGGGGTGGAGATAGGGAATCTCTGCTGAAACGCA
GTGCAGCGGCTATGTCGAAGCTGAAGTCTGCCAAAATCCCCCAGGACTTGGATTGGATTGAGCCGGATCTTCTGC
GGTCCTATGAAAATATGAGTGGACCGGGCGAAACTGCTCAAGTGCACCCATACTTCTTCACTACCTCTATTGCAA
AGCTCGCCCAGGACGAGGGCGCAAGTATCATTCTTGGACAGGTTACAGATATTGATCGGTCCAAGGGTTCTGTGC
AGTCAGTGACATACACTGATAAGACATCAGGTGAAACAAAAACCATCACCGCAACCGATGTGCTCGTTGCTGCTG
GTCCCTGGACGAAGACTATCCTCCCAGAGGTCCCCATCTCAGGCATGCGGGCCCACAGCGTGGTGATCCAGCCAA
AGAAACCAGTCAGCGCATACTGCCTGTTTACAAACATCGAAATCCCGGCCGACTTCAACCCCGAAAAGAAGTCAC
GCCCAACTGTGGCTGCGCCAGAGATCTACGCGCGCCCTGATGACACCGTCTATGCATGTGGCGACGGAGATAGAA
CGGTCTCATTACCAAAGACTTCTGCAGATGTCCAGGTTGACCAGACGCGCTGCCAGGAAATCATAGATCATGTGG
GTAGCATTTCTGACGAGCTGCGCGACGGAGAGGTTCGCGCTCGCCAGGCTTGCTATCTTCCTAACTGTGAAACTG
GCGGTGGGCCACTAATTGGCTTGACCGATGTAAAGGGACTGTATGTTGCAGCTGGCCATACCTGCTGGGGTATCC
AGAATGCGCCGGGTACAGGGAAGCTCATGAGTGAGTTTGTATTTGATGGCAAGGCGAAGAGCGCAAACATTGGAT
CGTTGGATCCACGAAACTTCATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail