Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6990.t1
Gene name
Locationscaffold_20:166408..169054
Strand-
Gene length (bp)2646
Transcript length (bp)2472
Coding sequence length (bp)2472
Protein length (aa) 824

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03200 Glyco_hydro_63 Glycosyl hydrolase family 63 C-terminal domain 2.0E-175 309 809
PF16923 Glyco_hydro_63N Glycosyl hydrolase family 63 N-terminal domain 2.1E-89 42 270

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 58.89 36.03 81.74
5d_25C Five days - 25 degrees Celsius 38.28 22.93 53.63
7d_25C Seven days - 25 degrees Celsius 29.10 16.96 41.25
10d_25C Ten days - 25 degrees Celsius 24.25 14.16 34.34
7d_15C Seven days - 15 degrees Celsius 34.57 19.20 49.94
7d_30C Seven days - 30 degrees Celsius 51.58 29.93 73.22

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.042216 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.016098 yes
3d_25C 7d_30C 0.646625 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.258933 no
5d_25C 7d_15C 0.747272 no
5d_25C 7d_30C 0.218207 no
5d_25C 10d_25C 0.036724 yes
7d_25C 7d_15C 0.552401 no
7d_25C 7d_30C 0.010083 yes
7d_25C 10d_25C 0.506382 no
7d_15C 7d_30C 0.101148 no
7d_15C 10d_25C 0.151958 no
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6990.t1
MRNLGISVLLTSLLYATGIVANEDPNDVSVLIREAGRASNESLLWGPYKSNLYFGVRPRIPKSLSAGLIWGKVDD
YAGAQQNFRHTCEQNEGMAGYGWDEYDIRKGGRETIHDAGNNLDLVIDFIKVPGGQHGGSWGFRVKGTPREGADP
DQPISVIFYSTLEGFGRLEADSASSESTGVEGNVKLEGYSAELGDFAIDVTTGPETNSHPRYNHPSSTDKPLDRS
IVASVAFPEEQLWQAKGIFFTQLKAEVDEALEEYGKENIPPPAQLFTIKHKPGPGNAQLVQKVFSGPFEFDVLFS
SGSASEPLTSETLTKEIDEASASFSETFEELLPPQAPFDSPKYSSFSKAMLSNLIGGIGFFHGDDVVDRSANPAY
EEENEGFWEETAEARAAAQPVIEGPKELFTCVPSRPFFPRGFLWDEGFHLMPVIEYDTDLALEIIKSWFHLMDED
GWIAREQILGQEARSKVPAEFTVQYPHYANPPTLFMALEAFMDKVKTSKNKSTEFASLDNQDATASLRSATVRHP
ELSEAYLRSFYPLLKKHYNWYRNTQRGDIKSYDREAFSTKEGYRWRGRSVQHILTSGIDDYPRAQPPHPGELHVD
LISWMGMMTRAMRRIAENLGEEEDAEKFASYENAITRNIDDLHWDEKEQTFCDATIDEYEESVHVCHKGYISIFP
FLTGMLGPDSPRLKAVLDLIGDPEELWSDYGIRSLSKKDKFYETDENYWRSPVWININYLVLKNLYDTATVSGPH
QEQAREMYSDLRKNLVENVFREWKRTGFAWEQYNPDSGNGQRTQHFTGWTSMVVNMMSMPDLAGFGKTTHDEL*
Coding >Pro_DTO377G3_2|g6990.t1
ATGCGTAACCTCGGGATTTCAGTGTTATTGACGTCGCTTCTCTATGCGACTGGGATTGTTGCAAATGAAGATCCC
AATGATGTGTCCGTCCTAATTCGAGAGGCCGGACGTGCCAGCAACGAGTCCTTGCTTTGGGGCCCCTACAAGTCG
AATCTCTACTTTGGGGTGCGTCCTCGCATTCCGAAGAGTCTTTCGGCGGGGTTGATCTGGGGAAAGGTTGACGAT
TATGCTGGTGCTCAACAAAACTTTAGACACACATGCGAACAAAATGAAGGAATGGCTGGGTATGGCTGGGATGAG
TACGATATCCGAAAAGGTGGACGGGAAACCATTCATGACGCTGGGAACAATTTGGACTTGGTCATCGATTTCATC
AAAGTACCCGGTGGCCAGCACGGAGGTAGCTGGGGATTCCGAGTCAAGGGCACGCCTAGGGAGGGCGCAGACCCC
GACCAGCCCATCTCCGTTATCTTTTATTCCACTCTCGAGGGATTCGGTCGCTTGGAGGCCGATTCTGCATCCTCT
GAATCCACTGGAGTGGAAGGCAATGTCAAGCTCGAAGGATACTCCGCAGAACTTGGTGATTTCGCTATCGATGTC
ACCACTGGACCGGAAACCAACTCGCACCCTCGCTACAATCATCCTAGCTCCACAGACAAGCCATTGGATCGCAGC
ATTGTAGCTAGTGTGGCTTTCCCTGAGGAGCAACTTTGGCAAGCGAAGGGAATCTTCTTCACTCAATTGAAGGCA
GAGGTTGACGAAGCCCTTGAAGAGTATGGAAAAGAGAACATTCCGCCCCCGGCCCAGCTGTTTACTATCAAGCAC
AAACCTGGCCCGGGAAACGCTCAGCTTGTCCAGAAGGTTTTCAGCGGTCCATTCGAGTTCGATGTCCTATTCTCC
TCCGGATCCGCTTCCGAACCTTTGACTTCAGAAACCCTTACTAAAGAAATTGATGAAGCTTCGGCTTCATTTTCT
GAAACCTTTGAGGAGCTTCTTCCGCCGCAGGCGCCATTTGACTCACCGAAATACTCGAGCTTCTCCAAGGCAATG
TTATCTAACCTGATCGGTGGCATTGGGTTCTTCCACGGCGATGATGTCGTAGATCGGTCCGCAAACCCTGCGTAC
GAAGAGGAGAATGAAGGCTTCTGGGAAGAGACCGCCGAGGCCAGGGCTGCCGCGCAGCCTGTTATCGAAGGCCCT
AAGGAGCTTTTCACTTGCGTTCCCTCCCGGCCTTTCTTCCCTAGAGGATTCCTTTGGGACGAAGGTTTCCATTTG
ATGCCCGTGATCGAATACGATACCGATCTTGCGCTTGAGATTATCAAGAGCTGGTTCCACTTAATGGACGAGGAT
GGGTGGATTGCCCGCGAACAGATTCTCGGCCAAGAGGCACGCAGCAAGGTACCTGCGGAGTTTACGGTCCAATAT
CCTCATTACGCAAACCCGCCTACTCTATTTATGGCCTTGGAAGCATTTATGGACAAAGTCAAGACCAGTAAAAAC
AAGAGCACCGAGTTCGCATCCCTAGACAACCAAGATGCGACCGCCAGCCTGCGTTCCGCCACTGTCCGACACCCG
GAACTGTCTGAAGCATACCTTCGCTCATTCTACCCGCTCCTGAAGAAGCACTACAACTGGTACAGAAATACTCAG
CGCGGTGATATCAAATCGTATGACCGTGAAGCGTTCTCGACTAAGGAAGGTTACCGCTGGCGCGGACGTTCAGTG
CAGCACATCCTCACTTCTGGCATCGATGACTACCCCAGAGCCCAGCCACCGCACCCCGGTGAGCTGCATGTCGAT
TTGATCAGTTGGATGGGAATGATGACTCGCGCTATGCGTCGCATTGCTGAGAACCTTGGTGAGGAGGAAGACGCT
GAGAAGTTCGCCTCCTACGAGAACGCTATCACTCGTAACATCGATGACTTGCACTGGGATGAGAAGGAGCAAACC
TTCTGCGATGCGACCATTGATGAATATGAAGAGAGTGTGCACGTCTGCCACAAGGGTTACATCTCCATCTTCCCC
TTCCTGACTGGTATGTTGGGTCCTGACAGCCCGCGTCTCAAGGCTGTGTTGGACTTGATCGGTGATCCCGAGGAG
CTGTGGAGTGATTACGGTATCCGCAGCTTAAGCAAGAAGGATAAGTTCTACGAAACCGACGAAAACTATTGGAGA
AGTCCTGTCTGGATTAACATCAACTACTTGGTGTTGAAGAATCTCTATGACACTGCGACGGTTTCTGGTCCTCAC
CAGGAACAGGCGAGAGAGATGTACTCTGACTTGCGGAAGAATTTGGTCGAAAATGTCTTCCGCGAGTGGAAGAGG
ACTGGATTCGCTTGGGAACAGTACAACCCTGACTCGGGCAATGGCCAGCGAACACAGCACTTTACCGGCTGGACT
AGTATGGTGGTGAACATGATGTCCATGCCTGATTTGGCCGGATTCGGAAAGACTACTCATGACGAGTTGTAA
Transcript >Pro_DTO377G3_2|g6990.t1
ATGCGTAACCTCGGGATTTCAGTGTTATTGACGTCGCTTCTCTATGCGACTGGGATTGTTGCAAATGAAGATCCC
AATGATGTGTCCGTCCTAATTCGAGAGGCCGGACGTGCCAGCAACGAGTCCTTGCTTTGGGGCCCCTACAAGTCG
AATCTCTACTTTGGGGTGCGTCCTCGCATTCCGAAGAGTCTTTCGGCGGGGTTGATCTGGGGAAAGGTTGACGAT
TATGCTGGTGCTCAACAAAACTTTAGACACACATGCGAACAAAATGAAGGAATGGCTGGGTATGGCTGGGATGAG
TACGATATCCGAAAAGGTGGACGGGAAACCATTCATGACGCTGGGAACAATTTGGACTTGGTCATCGATTTCATC
AAAGTACCCGGTGGCCAGCACGGAGGTAGCTGGGGATTCCGAGTCAAGGGCACGCCTAGGGAGGGCGCAGACCCC
GACCAGCCCATCTCCGTTATCTTTTATTCCACTCTCGAGGGATTCGGTCGCTTGGAGGCCGATTCTGCATCCTCT
GAATCCACTGGAGTGGAAGGCAATGTCAAGCTCGAAGGATACTCCGCAGAACTTGGTGATTTCGCTATCGATGTC
ACCACTGGACCGGAAACCAACTCGCACCCTCGCTACAATCATCCTAGCTCCACAGACAAGCCATTGGATCGCAGC
ATTGTAGCTAGTGTGGCTTTCCCTGAGGAGCAACTTTGGCAAGCGAAGGGAATCTTCTTCACTCAATTGAAGGCA
GAGGTTGACGAAGCCCTTGAAGAGTATGGAAAAGAGAACATTCCGCCCCCGGCCCAGCTGTTTACTATCAAGCAC
AAACCTGGCCCGGGAAACGCTCAGCTTGTCCAGAAGGTTTTCAGCGGTCCATTCGAGTTCGATGTCCTATTCTCC
TCCGGATCCGCTTCCGAACCTTTGACTTCAGAAACCCTTACTAAAGAAATTGATGAAGCTTCGGCTTCATTTTCT
GAAACCTTTGAGGAGCTTCTTCCGCCGCAGGCGCCATTTGACTCACCGAAATACTCGAGCTTCTCCAAGGCAATG
TTATCTAACCTGATCGGTGGCATTGGGTTCTTCCACGGCGATGATGTCGTAGATCGGTCCGCAAACCCTGCGTAC
GAAGAGGAGAATGAAGGCTTCTGGGAAGAGACCGCCGAGGCCAGGGCTGCCGCGCAGCCTGTTATCGAAGGCCCT
AAGGAGCTTTTCACTTGCGTTCCCTCCCGGCCTTTCTTCCCTAGAGGATTCCTTTGGGACGAAGGTTTCCATTTG
ATGCCCGTGATCGAATACGATACCGATCTTGCGCTTGAGATTATCAAGAGCTGGTTCCACTTAATGGACGAGGAT
GGGTGGATTGCCCGCGAACAGATTCTCGGCCAAGAGGCACGCAGCAAGGTACCTGCGGAGTTTACGGTCCAATAT
CCTCATTACGCAAACCCGCCTACTCTATTTATGGCCTTGGAAGCATTTATGGACAAAGTCAAGACCAGTAAAAAC
AAGAGCACCGAGTTCGCATCCCTAGACAACCAAGATGCGACCGCCAGCCTGCGTTCCGCCACTGTCCGACACCCG
GAACTGTCTGAAGCATACCTTCGCTCATTCTACCCGCTCCTGAAGAAGCACTACAACTGGTACAGAAATACTCAG
CGCGGTGATATCAAATCGTATGACCGTGAAGCGTTCTCGACTAAGGAAGGTTACCGCTGGCGCGGACGTTCAGTG
CAGCACATCCTCACTTCTGGCATCGATGACTACCCCAGAGCCCAGCCACCGCACCCCGGTGAGCTGCATGTCGAT
TTGATCAGTTGGATGGGAATGATGACTCGCGCTATGCGTCGCATTGCTGAGAACCTTGGTGAGGAGGAAGACGCT
GAGAAGTTCGCCTCCTACGAGAACGCTATCACTCGTAACATCGATGACTTGCACTGGGATGAGAAGGAGCAAACC
TTCTGCGATGCGACCATTGATGAATATGAAGAGAGTGTGCACGTCTGCCACAAGGGTTACATCTCCATCTTCCCC
TTCCTGACTGGTATGTTGGGTCCTGACAGCCCGCGTCTCAAGGCTGTGTTGGACTTGATCGGTGATCCCGAGGAG
CTGTGGAGTGATTACGGTATCCGCAGCTTAAGCAAGAAGGATAAGTTCTACGAAACCGACGAAAACTATTGGAGA
AGTCCTGTCTGGATTAACATCAACTACTTGGTGTTGAAGAATCTCTATGACACTGCGACGGTTTCTGGTCCTCAC
CAGGAACAGGCGAGAGAGATGTACTCTGACTTGCGGAAGAATTTGGTCGAAAATGTCTTCCGCGAGTGGAAGAGG
ACTGGATTCGCTTGGGAACAGTACAACCCTGACTCGGGCAATGGCCAGCGAACACAGCACTTTACCGGCTGGACT
AGTATGGTGGTGAACATGATGTCCATGCCTGATTTGGCCGGATTCGGAAAGACTACTCATGACGAGTTGTAA
Gene >Pro_DTO377G3_2|g6990.t1
ATGCGTAACCTCGGGATTTCAGTGTTATTGACGTCGCTTCTCTATGCGACTGGGATTGTTGCAAATGAAGATCCC
AATGATGTGTCCGTCCTAATTCGAGAGGCCGGACGTGCCAGCAACGAGTCCTTGCTTTGGGGCCCCTACAAGTCG
AATCTCTACTTTGGGGTGCGTCCTCGCATTCCGAAGAGTCTTTCGGCGGGGTTGATCTGGGGAAAGGTTGACGAT
TATGCTGGTGCTCAACAAAGTATGTGATCCTTGGCAGCCCGGTTGCATTGGTGAATTAAAGCTAACATCTACCGA
AGACTTTAGACACACATGCGAACAAAATGAAGGAATGGCTGGGTATGGCTGGGATGAGTACGATATCCGAAAAGG
TGGACGGGAAACCATTCATGACGCTGGGAACAATTTGGACTTGGTCATCGATTTCATCAAAGTACCCGGTGGCCA
GCACGGAGGTAGCTGGGGATTCCGAGTCAAGGGCACGCCTAGGGAGGGCGCAGACCCCGACCAGCCCATCTCCGT
TATCTTTTATTCCACTCTCGAGGGATTCGGTCGCTTGGAGGCCGATTCTGCATCCTCTGAATCCACTGGAGTGGA
AGGCAATGTCAAGCTCGAAGGATACTCCGCAGAACTTGGTGATTTCGCTATCGATGTCACCACTGGACCGGAAAC
CAACTCGCACCCTCGCTACAATCATCCTAGCTCCACAGACAAGCCATTGGATCGCAGCATTGTAGCTAGTGTGGC
TTTCCCTGAGGAGCAACTTTGGCAAGCGAAGGGAATCTTCTTCACTCAATTGAAGGCAGAGGTTGACGAAGCCCT
TGAAGAGTATGGAAAAGAGAACATTCCGCCCCCGGCCCAGCTGTTTACTATCAAGCACAAACCTGGCCCGGGAAA
CGCTCAGCTTGTCCAGAAGGTTTTCAGCGGTCCATTCGAGTTCGATGTCCTATTCTCCTCCGGATCCGCTTCCGA
ACCTTTGACTTCAGAAACCCTTACTAAAGAAATTGATGAAGCTTCGGCTTCATTTTCTGAAACCTTTGAGGAGCT
TCTTCCGCCGCAGGCGCCATTTGACTCACCGAAATACTCGAGCTTCTCCAAGGCAATGTTATCTAACCTGATCGG
TGGCATTGGGTTCTTCCACGGCGATGATGTCGTAGATCGGTCCGCAAACCCTGCGTACGAAGAGGAGAATGAAGG
CTTCTGGGAAGAGACCGCCGAGGCCAGGGCTGCCGCGCAGCCTGTTATCGAAGGCCCTAAGGAGCTTTTCACTTG
CGTTCCCTCCCGGCCTTTCTTCCCTAGAGGATTCCTTTGGGACGAAGGTTTCCATTTGATGCCCGTGATCGAATA
CGATACCGATCTTGCGTACGTTTACACCCACTTTCGTTTGACTCACTAGTTTTGCCTGATACTGACTTTTACAGG
CTTGAGATTATCAAGAGCTGGTTCCACTTAATGGACGAGGATGGGTGGATTGCCCGCGAACAGATTCTCGGCCAA
GAGGCACGCAGCAAGGTACCTGCGGAGTTTACGGTCCAATATCCTCATTACGCAAACCCGCCTACTCTATTTATG
GCCTTGGAAGCATTTATGGACAAAGTCAAGACCAGTAAAAACAAGAGCACCGAGTTCGCATCCCTAGACAACCAA
GATGCGACCGCCAGCCTGCGTTCCGCCACTGTCCGACACCCGGAACTGTCTGAAGCATACCTTCGCTCATTCTAC
CCGCTCCTGAAGAAGCACTACAACTGGTACAGAAATACTCAGCGCGGTGATATCAAATCGTATGACCGTGAAGCG
TTCTCGACTAAGGAAGGTTACCGCTGGCGCGGACGTTCAGTGCAGCACATCCTCACTTCTGGCATCGATGACTAC
CCCAGAGCCCAGCCACCGCACCCCGGTGAGCTGCATGTCGATTTGATCAGTTGGATGGGAATGATGACTCGCGCT
ATGCGTCGCATTGCTGAGAACCTTGGTGAGGAGGAAGACGCTGAGAAGTTCGCCTCCTACGAGAACGCTATCACT
CGTAACATCGATGACTTGCACTGGGATGAGAAGGAGCAAACCTTCTGCGATGCGACCATTGATGAATATGAAGAG
AGTGTGCACGTCTGCCACAAGGGTTACATCTCCATCTTCCCCTTCCTGACTGGTATGTTGGGTCCTGACAGCCCG
CGTCTCAAGGCTGTGTTGGACTTGATCGGTGATCCCGAGGAGCTGTGGAGTGATTACGGTATCCGCAGCTTAAGC
AAGAAGGATAAGTTCTACGAAACCGACGAAAACTATTGGAGAAGTCCTGTCTGGATTAACATCAACTACTTGGTG
TTGAAGAATCTCTATGTAAGTGCTTCGATCTTTTGATTTATTTGCCCGCCGAATCTGACAGAACCTTCACAGGAC
ACTGCGACGGTTTCTGGTCCTCACCAGGAACAGGCGAGAGAGATGTACTCTGACTTGCGGAAGAATTTGGTCGAA
AATGTCTTCCGCGAGTGGAAGAGGACTGGATTCGCTTGGGAACAGTACAACCCTGACTCGGGCAATGGCCAGCGA
ACACAGCACTTTACCGGCTGGACTAGTATGGTGGTGAACATGATGTCCATGCCTGATTTGGCCGGATTCGGAAAG
ACTACTCATGACGAGTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail