Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6978.t1
Gene name
Locationscaffold_20:136545..138068
Strand-
Gene length (bp)1523
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12013 OrsD Orsellinic acid/F9775 biosynthesis cluster protein D 4.8E-24 14 115
PF11951 Fungal_trans_2 Fungal specific transcription factor domain 2.1E-10 191 291

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6978.t1
MTLKSVDGLTPPELLHYLPTYRVLICRRCSYAIQPGAVARHLKEIHHLHHSSRRAFIEYASRFELTQPNDVVLPD
ETQFPVPLLPIQNGLACSFARCAHLCVTTKRMKQHWMTVHHIAASDNGGFWDPVPLQSFFRGNAFRYFTNPALLI
SSSSSASSDGLPSTAVTTPASRSNHGESCPLQPLITTDVGLLDHYQNHTYKILTCGPETDDAFRIIVPQLGTQFP
FLLHGILSCSAIHLAFIDPPNRVYYTIQSIRHQNQAAPAFRWATMHVDSNNSQAVLAFAFFLVVYTLGSQSNDEP
LFLSNDDNPEDAPSSNWIEILRNGCSMLCPVWTELSTGPLAPFTTLWREDLGVTADPNDPLLITLLSVIPDRESD
SAECSIYRDSAVKLAVAFAFIKTCGPSPSIWDALNSWPMRVSPDYLALLKQNNPGALLLLSYYAILLQPLRGEWF
LEGRVIRLVDEIARRLRGNCSTQIWKVFSTMREEYFSY*
Coding >Pro_DTO377G3_2|g6978.t1
ATGACTTTAAAATCAGTGGATGGGCTCACTCCACCCGAGCTATTACATTATCTGCCTACATATCGAGTATTGATC
TGCCGGCGTTGCAGCTACGCTATCCAGCCTGGTGCTGTCGCTCGCCATCTTAAGGAAATCCACCATCTTCATCAT
TCATCGCGTCGAGCATTCATCGAATACGCCTCTAGATTTGAACTGACCCAACCTAATGATGTCGTCTTGCCCGAT
GAAACCCAGTTCCCAGTGCCTTTACTGCCCATACAAAATGGGCTAGCCTGTTCCTTTGCTCGCTGTGCTCATCTT
TGTGTTACAACCAAGCGCATGAAGCAGCACTGGATGACTGTTCACCATATCGCAGCCTCTGATAACGGAGGCTTC
TGGGACCCAGTGCCATTACAAAGCTTTTTTCGAGGAAATGCCTTCCGCTACTTTACCAACCCAGCGTTGTTGATC
TCGTCGTCATCATCTGCCAGTTCCGATGGGCTACCGAGTACCGCTGTGACAACTCCAGCTTCAAGATCGAATCAT
GGAGAATCATGTCCCTTACAACCGTTGATCACAACCGACGTAGGATTACTCGATCATTACCAGAACCATACCTAC
AAAATCCTCACATGCGGCCCGGAGACAGATGATGCATTTCGAATCATTGTTCCCCAGTTAGGCACGCAATTCCCC
TTCCTACTCCATGGAATCCTATCCTGTTCCGCCATCCACCTTGCTTTTATCGATCCACCCAATCGAGTATATTAC
ACGATCCAGTCAATCCGACACCAAAATCAGGCAGCCCCTGCATTCCGATGGGCAACTATGCACGTGGATAGTAAT
AATAGCCAGGCCGTGTTGGCTTTTGCATTCTTCCTCGTCGTCTATACCCTAGGCTCCCAATCCAACGACGAACCA
TTGTTTCTTAGCAATGATGATAACCCAGAAGACGCGCCGTCATCAAACTGGATCGAGATACTGCGTAACGGCTGC
TCCATGCTCTGTCCCGTCTGGACGGAACTCAGTACTGGCCCCTTGGCACCTTTTACAACCCTTTGGCGAGAGGAT
CTCGGCGTCACTGCCGACCCCAACGACCCACTTCTAATTACTCTACTCTCCGTCATACCGGACCGTGAATCCGAC
TCCGCTGAATGCTCTATATACCGCGATTCGGCTGTCAAATTGGCAGTCGCTTTTGCGTTTATCAAGACTTGCGGA
CCTTCGCCGAGTATCTGGGATGCTCTTAATTCATGGCCAATGCGCGTTTCGCCTGACTACCTGGCCCTATTGAAA
CAGAACAACCCGGGTGCTTTACTGCTATTGTCATACTATGCTATCCTTCTACAGCCACTGAGGGGAGAATGGTTT
CTGGAAGGTCGCGTCATCAGATTGGTAGATGAAATCGCCCGACGATTAAGGGGGAATTGCTCGACACAGATCTGG
AAGGTGTTTTCTACCATGCGGGAGGAGTATTTTTCATACTGA
Transcript >Pro_DTO377G3_2|g6978.t1
ATGACTTTAAAATCAGTGGATGGGCTCACTCCACCCGAGCTATTACATTATCTGCCTACATATCGAGTATTGATC
TGCCGGCGTTGCAGCTACGCTATCCAGCCTGGTGCTGTCGCTCGCCATCTTAAGGAAATCCACCATCTTCATCAT
TCATCGCGTCGAGCATTCATCGAATACGCCTCTAGATTTGAACTGACCCAACCTAATGATGTCGTCTTGCCCGAT
GAAACCCAGTTCCCAGTGCCTTTACTGCCCATACAAAATGGGCTAGCCTGTTCCTTTGCTCGCTGTGCTCATCTT
TGTGTTACAACCAAGCGCATGAAGCAGCACTGGATGACTGTTCACCATATCGCAGCCTCTGATAACGGAGGCTTC
TGGGACCCAGTGCCATTACAAAGCTTTTTTCGAGGAAATGCCTTCCGCTACTTTACCAACCCAGCGTTGTTGATC
TCGTCGTCATCATCTGCCAGTTCCGATGGGCTACCGAGTACCGCTGTGACAACTCCAGCTTCAAGATCGAATCAT
GGAGAATCATGTCCCTTACAACCGTTGATCACAACCGACGTAGGATTACTCGATCATTACCAGAACCATACCTAC
AAAATCCTCACATGCGGCCCGGAGACAGATGATGCATTTCGAATCATTGTTCCCCAGTTAGGCACGCAATTCCCC
TTCCTACTCCATGGAATCCTATCCTGTTCCGCCATCCACCTTGCTTTTATCGATCCACCCAATCGAGTATATTAC
ACGATCCAGTCAATCCGACACCAAAATCAGGCAGCCCCTGCATTCCGATGGGCAACTATGCACGTGGATAGTAAT
AATAGCCAGGCCGTGTTGGCTTTTGCATTCTTCCTCGTCGTCTATACCCTAGGCTCCCAATCCAACGACGAACCA
TTGTTTCTTAGCAATGATGATAACCCAGAAGACGCGCCGTCATCAAACTGGATCGAGATACTGCGTAACGGCTGC
TCCATGCTCTGTCCCGTCTGGACGGAACTCAGTACTGGCCCCTTGGCACCTTTTACAACCCTTTGGCGAGAGGAT
CTCGGCGTCACTGCCGACCCCAACGACCCACTTCTAATTACTCTACTCTCCGTCATACCGGACCGTGAATCCGAC
TCCGCTGAATGCTCTATATACCGCGATTCGGCTGTCAAATTGGCAGTCGCTTTTGCGTTTATCAAGACTTGCGGA
CCTTCGCCGAGTATCTGGGATGCTCTTAATTCATGGCCAATGCGCGTTTCGCCTGACTACCTGGCCCTATTGAAA
CAGAACAACCCGGGTGCTTTACTGCTATTGTCATACTATGCTATCCTTCTACAGCCACTGAGGGGAGAATGGTTT
CTGGAAGGTCGCGTCATCAGATTGGTAGATGAAATCGCCCGACGATTAAGGGGGAATTGCTCGACACAGATCTGG
AAGGTGTTTTCTACCATGCGGGAGGAGTATTTTTCATACTGA
Gene >Pro_DTO377G3_2|g6978.t1
ATGACTTTAAAATCAGTGGATGGGCTCACTCCACCCGAGCTATTACATTATCTGCCTACATATCGAGTATTGATC
TGCCGGCGTTGCAGCTACGCTATCCAGCCTGGTGCTGTCGCTCGCCATCTTAAGGAAATCCACCATCTTCATCAT
TCATCGCGTCGAGCATTCATCGAATACGCCTCTAGATTTGAACTGACCCAACCTAATGATGTCGTCTTGCCCGAT
GAAACCCAGTTCCCAGTGCCTTTACTGCCCATACAAAATGGGCTAGCCTGTTCCTTTGCTCGCTGTGCTCATCTT
TGTGTTACAACCAAGCGCATGAAGCAGCACTGGATGACTGTTCACCATATCGCAGCCTCTGATAACGGAGGCTTC
TGGGACCCAGTGCCATTACAAAGCTTTTTTCGAGGAAATGCCTTCCGCTACTTTACCAACCCAGCGTTGTTGATC
TCGTCGTCATCATCTGCCAGTTCCGATGGGCTACCGAGTACCGTAAGTCAAGATAATGACCACCAGCCACTATCA
ATCCAACTGATTTATTCCTTTAGGCTGTGACAACTCCAGCTTCAAGATCGAATCATGGAGAATCATGTCCCTTAC
AACCGTTGATCACAACCGACGTAGGATTACTCGATCATTACCAGAACCATACCTACAAAATCCTCACATGCGGCC
CGGAGACAGATGATGCATTTCGAATCATTGTTCCCCAGTTAGGCACGCAATTCCCCTTCCTACTCCATGGAATCC
TATCCTGTTCCGCCATCCACCTTGCTTTTATCGATCCACCCAATCGAGTATATTACACGATCCAGTCAATCCGAC
ACCAAAATCAGGCAGCCCCTGCATTCCGATGGGCAACTATGCACGTGGATAGTAATAATAGCCAGGCCGTGTTGG
CTTTTGCATTCTTCCTCGTCGTCTATACCCTAGGCTCCCAATCCAACGACGAACCATTGTTTCTTAGCAATGATG
ATAACCCAGAAGACGCGCCGTCATCAAACTGGATCGAGATACTGCGTAACGGCTGCTCCATGCTCTGTCCCGTCT
GGACGGAACTCAGTACTGGCCCCTTGGCACCTTTTACAACCCTTTGGCGAGAGGATCTCGGCGTCACTGCCGACC
CCAACGACCCACTTCTAATTACTCTACTCTCCGTCATACCGGACCGTGAATCCGACTCCGCTGAATGCTCTATAT
ACCGCGATTCGGCTGTCAAATTGGCAGTCGCTTTTGCGTTTATCAAGACTTGCGGACCTTCGCCGAGTATCTGGG
ATGCTCTTAATTCATGGCCAATGCGCGTTTCGCCTGACTACCTGGCCCTATTGAAACAGAACAACCCGGGTGCTT
TACTGCTATTGTCATACTATGCTATCCTTCTACAGCCACTGAGGGGAGAATGGTTTCTGGAAGGTCGCGTCATCA
GATTGGTAGATGAAATCGCCCGACGATTAAGGGGGAATTGCTCGACACAGATCTGGAAGGTGTTTTCTACCATGC
GGGAGGAGTATTTTTCATACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail