Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6964.t1
Gene name
Locationscaffold_20:99098..102878
Strand+
Gene length (bp)3780
Transcript length (bp)3780
Coding sequence length (bp)3780
Protein length (aa) 1260

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 3.1E-47 1023 1251
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 3.0E-16 176 225
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 6.9E-11 589 1008
PF13246 Cation_ATPase Cation transport ATPase (P-type) 8.9E-07 674 783

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

Domain # Start End Length
1 205 227 22
2 498 520 22
3 530 552 22
4 1056 1073 17
5 1083 1105 22
6 1134 1156 22
7 1166 1185 19
8 1192 1214 22
9 1224 1241 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6964.t1
MPSSSDYQHPLDHPDAPDAFSDSDDDLDLEELDPSTTSPQQSRDSRDYTGRKRSYGPGIALRNLRVGAASRWRRS
ASGRGDMEDDTDALLENGETQGLGDSHASSRNLEDDDAPLLDRRSSTRDLDDEPAKQGSRLRFPIFKIPAFLQGT
SIRFGLNDIPSENQPPREVLVGQYQAAKYPANVVSNAKYTPWSFLPRTLYNEFSFFFNIYFLLVALSQVIPVLRI
GYMSSYIAPLAFVVSISLGKEALDDIGRRRRDAEANAEEYCTVALGRSNEMEVTKKSRDLKVGDVLKVRKNQRLP
ADVVILKSISNDSGTPRHSLTEEPIPGTSSDLLEPGQGSSEPTINTTLKNGEDVGDSPSADTFIRTDQLDGETDW
KLRLPSMLSQSLPLGDLARLQITASAPDKRVNEFLGTISLGPPTGLYDAHVDKSSGPPTNEGTPAPVENQSAPLT
IDNTAWANTVLASNTTTYAVIIYTGSQTRASLSTSASRSKTGLLELEINNLTKILCALTFTLSIILVGLERFQPT
NDKKWYVAIMIYLILFSTIIPMSLRVNLDMAKSVYGRFIERDKDIPGTVVRTSTIPEDLGRIEYLLSDKTGTLTQ
NEMELKKIHVGTVSYANEAMDEVASFIRQAFAFSGNALITPSTVFGTQAGHATAPRTRREIGSRVRDIILALALC
HNVTPTTEEEDGRKVTSYQASSPDEIAIIRYTEEVGLKLAYRDRQSIVLESTDSKQVVVRARILDIFPFTSDSKR
MGIIVQFQHDEDILESSKDDSEIWFYQKGADTVMTTIVAANDWLDEETTNMAREGLRTLVVGRKRISAQQYQDFS
AKYKQASLSFQGRDAGMAKVVSEYLEQDLELSGVTGVEDRLQRDVKSSLELLRNAGVKIWMLTGDKVETARCVAI
SAKLVSRGQYIHTVTKVTDKSTAQEALDFLRNKTDCCLLIDGESLNLMLGQFKTAFISVAVLLPAVIACRCSPTQ
KAEIADLIRQHTKKRVCCIGDGGNDVSMIQAADVGIGIVGKEGRQASLAADFSITQFHHITKLLVWHGRNSYKRS
AKLAQFIMHRGLIISVCQTMYSIASHFDPKGLFINWLMVGYATVYTNAPVFSLAFDRDVDERLANLYPELYKELK
TGKSLSYRSFFGWVLISVYQGAVIQGLSQILLDTITGPRLISLSFTALVLNELGMVATSITTWHPVMIFCLIGTL
LVYAGSIPFLGEYFDLSYVITLDWLWRVFAVLAVSLVPVWAGKMIKQSWHPPSYRKVRG*
Coding >Pro_DTO377G3_2|g6964.t1
ATGCCTTCCTCATCCGACTACCAACACCCCCTAGACCATCCCGATGCGCCGGACGCCTTCTCGGACTCGGACGAT
GACTTGGATCTAGAAGAGCTAGACCCCAGCACGACATCCCCCCAACAGTCCCGGGATTCTCGGGACTATACTGGC
CGCAAAAGAAGCTACGGGCCGGGTATTGCGCTGCGCAACTTACGTGTCGGAGCGGCAAGTCGGTGGAGACGCAGT
GCGTCCGGACGTGGAGACATGGAGGATGATACCGATGCGCTTTTAGAGAACGGGGAGACACAAGGCTTGGGGGAC
TCACATGCAAGCTCTCGGAACTTGGAGGATGATGACGCGCCTCTACTAGATCGCAGAAGCTCGACTCGCGATTTG
GACGATGAGCCTGCCAAGCAAGGCAGCCGCTTGCGCTTCCCAATATTCAAAATTCCTGCATTCCTACAGGGCACA
TCAATTCGATTTGGATTAAATGATATTCCCTCTGAGAACCAACCTCCCCGTGAAGTACTTGTCGGACAATACCAG
GCGGCTAAGTATCCGGCTAATGTGGTCTCGAATGCAAAATACACACCCTGGAGCTTCCTACCGAGAACCCTTTAC
AACGAATTCTCCTTTTTTTTCAACATCTACTTCCTCCTTGTCGCTTTATCGCAGGTCATCCCGGTACTGCGAATT
GGTTATATGTCGTCTTACATTGCCCCTTTGGCCTTTGTGGTTTCAATATCATTGGGTAAAGAGGCACTTGATGAC
ATTGGTCGTCGGCGACGAGATGCCGAAGCCAATGCGGAAGAATATTGCACTGTGGCATTAGGAAGGTCCAACGAG
ATGGAGGTCACAAAAAAGTCGCGAGATCTGAAAGTTGGTGATGTGCTCAAAGTCCGCAAGAACCAACGCCTTCCT
GCCGATGTGGTAATTCTGAAGAGCATTTCAAATGATTCAGGCACTCCTCGTCATTCATTAACAGAAGAACCTATC
CCTGGGACGTCTTCCGACTTGCTCGAACCAGGTCAGGGATCGTCCGAACCCACAATCAACACCACATTGAAGAAT
GGTGAAGATGTTGGAGATTCACCCTCAGCTGATACTTTCATCCGAACTGATCAATTGGATGGTGAAACTGACTGG
AAGCTTCGTCTGCCTTCCATGCTGTCTCAATCGCTTCCTCTGGGTGATTTAGCTCGACTACAAATCACGGCTAGC
GCTCCTGATAAAAGAGTCAACGAATTCTTGGGGACTATTAGCTTGGGACCGCCCACTGGGCTCTACGATGCTCAC
GTTGACAAATCATCTGGGCCTCCAACCAATGAAGGAACGCCTGCGCCTGTGGAAAATCAATCAGCTCCCTTGACA
ATCGACAATACCGCCTGGGCCAACACTGTTCTTGCGTCCAATACCACCACTTACGCCGTCATCATCTATACGGGA
TCTCAAACCCGAGCTTCGCTTTCGACTTCCGCTTCCCGTTCGAAGACAGGCCTGTTAGAGCTCGAAATTAACAAC
CTCACCAAAATTCTTTGCGCCCTCACATTCACTCTCTCAATCATCCTTGTCGGGTTGGAAAGATTCCAACCAACA
AACGACAAGAAATGGTACGTTGCTATCATGATCTATCTTATTCTCTTCTCCACAATCATTCCCATGAGCCTTCGG
GTCAATCTGGACATGGCCAAGTCGGTATACGGGCGGTTCATCGAACGGGACAAGGACATTCCAGGAACTGTAGTC
CGCACCAGTACAATTCCAGAAGACCTGGGAAGGATCGAATACCTTCTTTCGGATAAGACGGGAACGTTGACCCAA
AATGAGATGGAGCTCAAAAAAATACACGTTGGCACTGTCTCATACGCCAACGAGGCAATGGACGAAGTCGCCTCG
TTTATTCGTCAGGCTTTTGCGTTTTCGGGCAATGCCTTGATTACCCCTTCAACTGTCTTTGGTACTCAGGCCGGA
CATGCCACAGCGCCGCGGACAAGAAGAGAGATTGGTTCCCGCGTCCGGGATATCATATTAGCACTTGCTCTCTGT
CACAACGTTACGCCGACCACAGAGGAGGAAGACGGCCGGAAGGTGACGAGCTATCAAGCGTCATCGCCTGATGAA
ATCGCCATTATTCGATATACCGAAGAAGTTGGATTAAAGCTAGCATATCGAGACAGACAAAGTATCGTCTTGGAA
TCCACCGACTCCAAGCAGGTTGTGGTCCGCGCTCGGATTCTCGACATCTTCCCATTCACATCCGACTCCAAGCGA
ATGGGGATTATCGTCCAATTCCAGCACGATGAAGACATACTTGAATCCAGCAAAGATGATAGTGAAATTTGGTTC
TATCAGAAAGGTGCAGACACTGTCATGACAACTATTGTTGCAGCAAATGACTGGCTTGACGAGGAGACTACGAAC
ATGGCTCGGGAAGGGTTGCGAACTCTCGTTGTTGGGCGCAAAAGAATCTCCGCACAGCAATACCAAGATTTCTCT
GCTAAATACAAACAAGCGTCACTGTCTTTCCAAGGGCGAGATGCAGGCATGGCGAAGGTTGTGAGCGAATACCTT
GAACAAGATTTGGAGCTTTCCGGTGTGACCGGTGTGGAAGATCGGCTGCAACGCGACGTCAAATCCTCTCTCGAG
CTGTTACGCAACGCCGGTGTTAAGATCTGGATGCTGACGGGTGACAAGGTGGAAACAGCTCGTTGTGTCGCTATT
TCTGCCAAATTGGTCTCTCGGGGCCAGTACATTCACACAGTCACCAAAGTCACAGACAAGTCGACTGCCCAAGAG
GCTCTTGACTTCTTGCGCAACAAGACTGACTGCTGCCTGCTCATTGATGGCGAGTCCTTGAACCTCATGCTTGGT
CAATTTAAAACAGCTTTCATCTCTGTCGCGGTGCTACTTCCCGCTGTGATCGCGTGCCGATGCTCCCCTACCCAG
AAAGCTGAGATTGCAGACCTGATTCGCCAACACACAAAGAAACGTGTCTGTTGTATCGGAGATGGCGGTAACGAT
GTCTCGATGATTCAAGCAGCCGATGTCGGAATTGGTATCGTGGGCAAGGAAGGCCGCCAAGCATCTCTGGCTGCT
GATTTTAGTATCACGCAGTTCCACCATATTACCAAGCTTCTCGTCTGGCACGGCCGCAACTCGTACAAGCGGTCT
GCTAAACTAGCGCAGTTCATCATGCACCGTGGGTTGATCATCAGTGTTTGCCAGACTATGTACAGCATTGCCAGC
CACTTCGATCCCAAGGGCTTGTTCATCAATTGGCTGATGGTCGGCTACGCCACTGTTTATACCAACGCACCGGTC
TTCTCCCTCGCCTTTGATCGGGATGTCGACGAGCGTCTTGCCAATCTCTACCCAGAGCTTTATAAAGAGCTCAAG
ACAGGGAAGAGTCTAAGCTACCGCTCGTTCTTTGGCTGGGTTCTCATTTCCGTCTACCAGGGTGCAGTGATCCAG
GGTCTCTCTCAGATATTGTTGGATACCATCACAGGGCCGCGCCTTATTAGTCTTTCCTTCACGGCCCTCGTCCTC
AATGAGCTTGGCATGGTCGCCACTTCAATCACAACATGGCACCCGGTCATGATCTTTTGTCTGATTGGTACGCTG
CTTGTATATGCAGGCAGTATCCCCTTCCTGGGCGAGTACTTCGACCTTAGTTACGTGATTACCCTTGACTGGTTG
TGGCGAGTTTTCGCCGTGCTGGCTGTGTCTCTGGTTCCGGTCTGGGCTGGCAAAATGATCAAACAGTCGTGGCAC
CCGCCAAGCTACCGAAAAGTTCGTGGATAG
Transcript >Pro_DTO377G3_2|g6964.t1
ATGCCTTCCTCATCCGACTACCAACACCCCCTAGACCATCCCGATGCGCCGGACGCCTTCTCGGACTCGGACGAT
GACTTGGATCTAGAAGAGCTAGACCCCAGCACGACATCCCCCCAACAGTCCCGGGATTCTCGGGACTATACTGGC
CGCAAAAGAAGCTACGGGCCGGGTATTGCGCTGCGCAACTTACGTGTCGGAGCGGCAAGTCGGTGGAGACGCAGT
GCGTCCGGACGTGGAGACATGGAGGATGATACCGATGCGCTTTTAGAGAACGGGGAGACACAAGGCTTGGGGGAC
TCACATGCAAGCTCTCGGAACTTGGAGGATGATGACGCGCCTCTACTAGATCGCAGAAGCTCGACTCGCGATTTG
GACGATGAGCCTGCCAAGCAAGGCAGCCGCTTGCGCTTCCCAATATTCAAAATTCCTGCATTCCTACAGGGCACA
TCAATTCGATTTGGATTAAATGATATTCCCTCTGAGAACCAACCTCCCCGTGAAGTACTTGTCGGACAATACCAG
GCGGCTAAGTATCCGGCTAATGTGGTCTCGAATGCAAAATACACACCCTGGAGCTTCCTACCGAGAACCCTTTAC
AACGAATTCTCCTTTTTTTTCAACATCTACTTCCTCCTTGTCGCTTTATCGCAGGTCATCCCGGTACTGCGAATT
GGTTATATGTCGTCTTACATTGCCCCTTTGGCCTTTGTGGTTTCAATATCATTGGGTAAAGAGGCACTTGATGAC
ATTGGTCGTCGGCGACGAGATGCCGAAGCCAATGCGGAAGAATATTGCACTGTGGCATTAGGAAGGTCCAACGAG
ATGGAGGTCACAAAAAAGTCGCGAGATCTGAAAGTTGGTGATGTGCTCAAAGTCCGCAAGAACCAACGCCTTCCT
GCCGATGTGGTAATTCTGAAGAGCATTTCAAATGATTCAGGCACTCCTCGTCATTCATTAACAGAAGAACCTATC
CCTGGGACGTCTTCCGACTTGCTCGAACCAGGTCAGGGATCGTCCGAACCCACAATCAACACCACATTGAAGAAT
GGTGAAGATGTTGGAGATTCACCCTCAGCTGATACTTTCATCCGAACTGATCAATTGGATGGTGAAACTGACTGG
AAGCTTCGTCTGCCTTCCATGCTGTCTCAATCGCTTCCTCTGGGTGATTTAGCTCGACTACAAATCACGGCTAGC
GCTCCTGATAAAAGAGTCAACGAATTCTTGGGGACTATTAGCTTGGGACCGCCCACTGGGCTCTACGATGCTCAC
GTTGACAAATCATCTGGGCCTCCAACCAATGAAGGAACGCCTGCGCCTGTGGAAAATCAATCAGCTCCCTTGACA
ATCGACAATACCGCCTGGGCCAACACTGTTCTTGCGTCCAATACCACCACTTACGCCGTCATCATCTATACGGGA
TCTCAAACCCGAGCTTCGCTTTCGACTTCCGCTTCCCGTTCGAAGACAGGCCTGTTAGAGCTCGAAATTAACAAC
CTCACCAAAATTCTTTGCGCCCTCACATTCACTCTCTCAATCATCCTTGTCGGGTTGGAAAGATTCCAACCAACA
AACGACAAGAAATGGTACGTTGCTATCATGATCTATCTTATTCTCTTCTCCACAATCATTCCCATGAGCCTTCGG
GTCAATCTGGACATGGCCAAGTCGGTATACGGGCGGTTCATCGAACGGGACAAGGACATTCCAGGAACTGTAGTC
CGCACCAGTACAATTCCAGAAGACCTGGGAAGGATCGAATACCTTCTTTCGGATAAGACGGGAACGTTGACCCAA
AATGAGATGGAGCTCAAAAAAATACACGTTGGCACTGTCTCATACGCCAACGAGGCAATGGACGAAGTCGCCTCG
TTTATTCGTCAGGCTTTTGCGTTTTCGGGCAATGCCTTGATTACCCCTTCAACTGTCTTTGGTACTCAGGCCGGA
CATGCCACAGCGCCGCGGACAAGAAGAGAGATTGGTTCCCGCGTCCGGGATATCATATTAGCACTTGCTCTCTGT
CACAACGTTACGCCGACCACAGAGGAGGAAGACGGCCGGAAGGTGACGAGCTATCAAGCGTCATCGCCTGATGAA
ATCGCCATTATTCGATATACCGAAGAAGTTGGATTAAAGCTAGCATATCGAGACAGACAAAGTATCGTCTTGGAA
TCCACCGACTCCAAGCAGGTTGTGGTCCGCGCTCGGATTCTCGACATCTTCCCATTCACATCCGACTCCAAGCGA
ATGGGGATTATCGTCCAATTCCAGCACGATGAAGACATACTTGAATCCAGCAAAGATGATAGTGAAATTTGGTTC
TATCAGAAAGGTGCAGACACTGTCATGACAACTATTGTTGCAGCAAATGACTGGCTTGACGAGGAGACTACGAAC
ATGGCTCGGGAAGGGTTGCGAACTCTCGTTGTTGGGCGCAAAAGAATCTCCGCACAGCAATACCAAGATTTCTCT
GCTAAATACAAACAAGCGTCACTGTCTTTCCAAGGGCGAGATGCAGGCATGGCGAAGGTTGTGAGCGAATACCTT
GAACAAGATTTGGAGCTTTCCGGTGTGACCGGTGTGGAAGATCGGCTGCAACGCGACGTCAAATCCTCTCTCGAG
CTGTTACGCAACGCCGGTGTTAAGATCTGGATGCTGACGGGTGACAAGGTGGAAACAGCTCGTTGTGTCGCTATT
TCTGCCAAATTGGTCTCTCGGGGCCAGTACATTCACACAGTCACCAAAGTCACAGACAAGTCGACTGCCCAAGAG
GCTCTTGACTTCTTGCGCAACAAGACTGACTGCTGCCTGCTCATTGATGGCGAGTCCTTGAACCTCATGCTTGGT
CAATTTAAAACAGCTTTCATCTCTGTCGCGGTGCTACTTCCCGCTGTGATCGCGTGCCGATGCTCCCCTACCCAG
AAAGCTGAGATTGCAGACCTGATTCGCCAACACACAAAGAAACGTGTCTGTTGTATCGGAGATGGCGGTAACGAT
GTCTCGATGATTCAAGCAGCCGATGTCGGAATTGGTATCGTGGGCAAGGAAGGCCGCCAAGCATCTCTGGCTGCT
GATTTTAGTATCACGCAGTTCCACCATATTACCAAGCTTCTCGTCTGGCACGGCCGCAACTCGTACAAGCGGTCT
GCTAAACTAGCGCAGTTCATCATGCACCGTGGGTTGATCATCAGTGTTTGCCAGACTATGTACAGCATTGCCAGC
CACTTCGATCCCAAGGGCTTGTTCATCAATTGGCTGATGGTCGGCTACGCCACTGTTTATACCAACGCACCGGTC
TTCTCCCTCGCCTTTGATCGGGATGTCGACGAGCGTCTTGCCAATCTCTACCCAGAGCTTTATAAAGAGCTCAAG
ACAGGGAAGAGTCTAAGCTACCGCTCGTTCTTTGGCTGGGTTCTCATTTCCGTCTACCAGGGTGCAGTGATCCAG
GGTCTCTCTCAGATATTGTTGGATACCATCACAGGGCCGCGCCTTATTAGTCTTTCCTTCACGGCCCTCGTCCTC
AATGAGCTTGGCATGGTCGCCACTTCAATCACAACATGGCACCCGGTCATGATCTTTTGTCTGATTGGTACGCTG
CTTGTATATGCAGGCAGTATCCCCTTCCTGGGCGAGTACTTCGACCTTAGTTACGTGATTACCCTTGACTGGTTG
TGGCGAGTTTTCGCCGTGCTGGCTGTGTCTCTGGTTCCGGTCTGGGCTGGCAAAATGATCAAACAGTCGTGGCAC
CCGCCAAGCTACCGAAAAGTTCGTGGATAG
Gene >Pro_DTO377G3_2|g6964.t1
ATGCCTTCCTCATCCGACTACCAACACCCCCTAGACCATCCCGATGCGCCGGACGCCTTCTCGGACTCGGACGAT
GACTTGGATCTAGAAGAGCTAGACCCCAGCACGACATCCCCCCAACAGTCCCGGGATTCTCGGGACTATACTGGC
CGCAAAAGAAGCTACGGGCCGGGTATTGCGCTGCGCAACTTACGTGTCGGAGCGGCAAGTCGGTGGAGACGCAGT
GCGTCCGGACGTGGAGACATGGAGGATGATACCGATGCGCTTTTAGAGAACGGGGAGACACAAGGCTTGGGGGAC
TCACATGCAAGCTCTCGGAACTTGGAGGATGATGACGCGCCTCTACTAGATCGCAGAAGCTCGACTCGCGATTTG
GACGATGAGCCTGCCAAGCAAGGCAGCCGCTTGCGCTTCCCAATATTCAAAATTCCTGCATTCCTACAGGGCACA
TCAATTCGATTTGGATTAAATGATATTCCCTCTGAGAACCAACCTCCCCGTGAAGTACTTGTCGGACAATACCAG
GCGGCTAAGTATCCGGCTAATGTGGTCTCGAATGCAAAATACACACCCTGGAGCTTCCTACCGAGAACCCTTTAC
AACGAATTCTCCTTTTTTTTCAACATCTACTTCCTCCTTGTCGCTTTATCGCAGGTCATCCCGGTACTGCGAATT
GGTTATATGTCGTCTTACATTGCCCCTTTGGCCTTTGTGGTTTCAATATCATTGGGTAAAGAGGCACTTGATGAC
ATTGGTCGTCGGCGACGAGATGCCGAAGCCAATGCGGAAGAATATTGCACTGTGGCATTAGGAAGGTCCAACGAG
ATGGAGGTCACAAAAAAGTCGCGAGATCTGAAAGTTGGTGATGTGCTCAAAGTCCGCAAGAACCAACGCCTTCCT
GCCGATGTGGTAATTCTGAAGAGCATTTCAAATGATTCAGGCACTCCTCGTCATTCATTAACAGAAGAACCTATC
CCTGGGACGTCTTCCGACTTGCTCGAACCAGGTCAGGGATCGTCCGAACCCACAATCAACACCACATTGAAGAAT
GGTGAAGATGTTGGAGATTCACCCTCAGCTGATACTTTCATCCGAACTGATCAATTGGATGGTGAAACTGACTGG
AAGCTTCGTCTGCCTTCCATGCTGTCTCAATCGCTTCCTCTGGGTGATTTAGCTCGACTACAAATCACGGCTAGC
GCTCCTGATAAAAGAGTCAACGAATTCTTGGGGACTATTAGCTTGGGACCGCCCACTGGGCTCTACGATGCTCAC
GTTGACAAATCATCTGGGCCTCCAACCAATGAAGGAACGCCTGCGCCTGTGGAAAATCAATCAGCTCCCTTGACA
ATCGACAATACCGCCTGGGCCAACACTGTTCTTGCGTCCAATACCACCACTTACGCCGTCATCATCTATACGGGA
TCTCAAACCCGAGCTTCGCTTTCGACTTCCGCTTCCCGTTCGAAGACAGGCCTGTTAGAGCTCGAAATTAACAAC
CTCACCAAAATTCTTTGCGCCCTCACATTCACTCTCTCAATCATCCTTGTCGGGTTGGAAAGATTCCAACCAACA
AACGACAAGAAATGGTACGTTGCTATCATGATCTATCTTATTCTCTTCTCCACAATCATTCCCATGAGCCTTCGG
GTCAATCTGGACATGGCCAAGTCGGTATACGGGCGGTTCATCGAACGGGACAAGGACATTCCAGGAACTGTAGTC
CGCACCAGTACAATTCCAGAAGACCTGGGAAGGATCGAATACCTTCTTTCGGATAAGACGGGAACGTTGACCCAA
AATGAGATGGAGCTCAAAAAAATACACGTTGGCACTGTCTCATACGCCAACGAGGCAATGGACGAAGTCGCCTCG
TTTATTCGTCAGGCTTTTGCGTTTTCGGGCAATGCCTTGATTACCCCTTCAACTGTCTTTGGTACTCAGGCCGGA
CATGCCACAGCGCCGCGGACAAGAAGAGAGATTGGTTCCCGCGTCCGGGATATCATATTAGCACTTGCTCTCTGT
CACAACGTTACGCCGACCACAGAGGAGGAAGACGGCCGGAAGGTGACGAGCTATCAAGCGTCATCGCCTGATGAA
ATCGCCATTATTCGATATACCGAAGAAGTTGGATTAAAGCTAGCATATCGAGACAGACAAAGTATCGTCTTGGAA
TCCACCGACTCCAAGCAGGTTGTGGTCCGCGCTCGGATTCTCGACATCTTCCCATTCACATCCGACTCCAAGCGA
ATGGGGATTATCGTCCAATTCCAGCACGATGAAGACATACTTGAATCCAGCAAAGATGATAGTGAAATTTGGTTC
TATCAGAAAGGTGCAGACACTGTCATGACAACTATTGTTGCAGCAAATGACTGGCTTGACGAGGAGACTACGAAC
ATGGCTCGGGAAGGGTTGCGAACTCTCGTTGTTGGGCGCAAAAGAATCTCCGCACAGCAATACCAAGATTTCTCT
GCTAAATACAAACAAGCGTCACTGTCTTTCCAAGGGCGAGATGCAGGCATGGCGAAGGTTGTGAGCGAATACCTT
GAACAAGATTTGGAGCTTTCCGGTGTGACCGGTGTGGAAGATCGGCTGCAACGCGACGTCAAATCCTCTCTCGAG
CTGTTACGCAACGCCGGTGTTAAGATCTGGATGCTGACGGGTGACAAGGTGGAAACAGCTCGTTGTGTCGCTATT
TCTGCCAAATTGGTCTCTCGGGGCCAGTACATTCACACAGTCACCAAAGTCACAGACAAGTCGACTGCCCAAGAG
GCTCTTGACTTCTTGCGCAACAAGACTGACTGCTGCCTGCTCATTGATGGCGAGTCCTTGAACCTCATGCTTGGT
CAATTTAAAACAGCTTTCATCTCTGTCGCGGTGCTACTTCCCGCTGTGATCGCGTGCCGATGCTCCCCTACCCAG
AAAGCTGAGATTGCAGACCTGATTCGCCAACACACAAAGAAACGTGTCTGTTGTATCGGAGATGGCGGTAACGAT
GTCTCGATGATTCAAGCAGCCGATGTCGGAATTGGTATCGTGGGCAAGGAAGGCCGCCAAGCATCTCTGGCTGCT
GATTTTAGTATCACGCAGTTCCACCATATTACCAAGCTTCTCGTCTGGCACGGCCGCAACTCGTACAAGCGGTCT
GCTAAACTAGCGCAGTTCATCATGCACCGTGGGTTGATCATCAGTGTTTGCCAGACTATGTACAGCATTGCCAGC
CACTTCGATCCCAAGGGCTTGTTCATCAATTGGCTGATGGTCGGCTACGCCACTGTTTATACCAACGCACCGGTC
TTCTCCCTCGCCTTTGATCGGGATGTCGACGAGCGTCTTGCCAATCTCTACCCAGAGCTTTATAAAGAGCTCAAG
ACAGGGAAGAGTCTAAGCTACCGCTCGTTCTTTGGCTGGGTTCTCATTTCCGTCTACCAGGGTGCAGTGATCCAG
GGTCTCTCTCAGATATTGTTGGATACCATCACAGGGCCGCGCCTTATTAGTCTTTCCTTCACGGCCCTCGTCCTC
AATGAGCTTGGCATGGTCGCCACTTCAATCACAACATGGCACCCGGTCATGATCTTTTGTCTGATTGGTACGCTG
CTTGTATATGCAGGCAGTATCCCCTTCCTGGGCGAGTACTTCGACCTTAGTTACGTGATTACCCTTGACTGGTTG
TGGCGAGTTTTCGCCGTGCTGGCTGTGTCTCTGGTTCCGGTCTGGGCTGGCAAAATGATCAAACAGTCGTGGCAC
CCGCCAAGCTACCGAAAAGTTCGTGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail