Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6963.t1
Gene name
Locationscaffold_20:92243..98339
Strand-
Gene length (bp)6096
Transcript length (bp)6039
Coding sequence length (bp)6039
Protein length (aa) 2013

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12931 Sec16_C Sec23-binding domain of Sec16 1.2E-107 1246 1543
PF12935 Sec16_N Vesicle coat trafficking protein Sec16 N-terminus 2.5E-74 367 612
PF12932 Sec16 Vesicle coat trafficking protein Sec16 mid-region 1.9E-34 1068 1185

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6963.t1
MAHQATENDSESWNPASRPDNNNSPVTIQSGLSDPIAADGPKDRSLDDVVSPQSEDFSAWDISDEVDGIQPQYTS
LDVLVNNESPVVDQDMCLDTDSVDKSSHVPDETIAATHTTTPSIENADTVLSQTLPKTQPAQPVQIEAPSVHGAE
TSNSFPTIINGFPSVHTENSDTVVPTVAPEQETAPESTFVGETTPPREETTASEPTLDTSKNKYTSQSTPTDELF
PGTDADNADSENPWATFEKDLSNTLPSTEEATPHNISELASTSTQIQDSDEPNFVEEAVRPLPEETAFTGATRDA
ESLDVFNSTENAIAPTENEQIDLVSHSINVESGNTGSPSPIAEAFAPTNDAHLDPAAAGVDTTTQDQPFWANESS
GEVESDEDGFFDQLNSQTKPIFAPPEAESRFEEGVPLLDESTPASPQHPTEQETSIDSVFANDEDDVDDFFISAP
KTEAKNADEDFFASTPKKEPEEQPVVHIARKSTSQVLESAGFALDSPVSDTSAAAQFDDALKAASLEPQTMADPS
EEELAARWEAELGDSLDDDLAARWEAALDDDDILLETEAAQSVSEQEHAHQTPVQPVNDGLVVGLNSPFQTPQVF
SQPRPVPNIYTPHQPSTGDLLQNIPLPGTAPPTTGAMSSYFSQQPQNPVAIRGESFAERSKEGYKSPYDLPDDIS
RPRKPVVTHKPVPPPVISMPPPPLPCASGIPIPAVAGFPPPAAPPSALAAPPAPKNFYEELPLPPPRSRPASSGR
YTPNPQTAPTMTGSSLPPPQVQYASVVPPAPQPIGLPIQSTLQPPEQLDPYASLSSSAPVGPPTVARYSPQPPGF
QAPPKPPSLPRYSPAPPPTSSVRNRYASQPLNVPGQNLPFQPRTSSPLAHHEKVSYQPDQSHRPPSLEPAINLSS
PREQGAGFGQIPPSAPQYFNGPANLPRRESAGSPLQPSPPQSRYAPQEYLNEFAQRLAPGPEHAPPAPPAPPANG
LSPPPSDFQMGPLRRSQTQSPARDLTSPRSYGQDIDPLQRPASVQVSSLPIQTVNPYAPVKPVHQTRAPTHHLEF
IAPNDGQEHDPLERWKGAPIFKFGFGGSMVSCFPKHVPRYSIGQVAPMIQPTLGEPKISQLSEWLPSADTIVQHP
GPLKAKSKKKDLVAWLSSKIAAFENSDLPSYEQVQSDTHKRQEEKTLLWKVVKLLVENDGNLESSPEIQTSLRHI
IFPNLPNSDADGSYASSLAPSGGVAPSETPLQADAVDAQWLEELRLHLICGDREKAVWSAVDRRLWGHAMIISST
MDRSISKQVAQEFVRREVRSKSANTESLAALYEIFAGNIEESIDELVAPSARAGLQLISMANGQGSTKNALEGLD
KWRDTLGLVLSNRSPGDHQALFSLGHLLSSYGRTEAAHVCYIFSRAAVFGGPDDPQANITLLGADHQRCPSSLMD
EDAILLTEAYEFAMSVLGNSPTAHLPHLLAFKILNARCLVDQGRNLEAQGYCDAVAAALKATTRPSPYYHQHLFA
EVEELSARLRQTTSDSGSWISRPSMEKVSGSMWARFNSFVVGDDSDAASTGSGKGGEHAEFGPFANVAGTPTISR
SPSVSEIYGSYPGAAAGAPLIPTSGASKYHPSSQYAPGASPEQFKGRSSIDSQRSASYFPPYGQRRSSQELSPSI
DQQMSYGAPGYGSPSAGGYQPTPPQSSYIPLAPVEEATSPAEAHPAAQSMVNGLFYHPPGQAATSSQSPYYQGPP
GMPASVPDSESPYAPPAASSSYEPVSYEPNSYEPAAAGVDMGYGSQEEDLPRAAEQPRKQSIMDDDDDDLAARAA
AIQKAENDRKANEAFAKAAEEDAKKGPQQSGKKGWFGGWFGGAKKEENSGGGPIRAKLGEESSFYYDKELKKWVN
KKDPGSSAPVHATPPPPRRSAPPSRTASSNSMPQNGAPPMPPMPPMSVSGGRPQSSSTAAPPFLSPSPGFPGLAP
RSVSTGAAMPTPPGSSSGPPPRPSSSLTHASSIDDLIGAPQARKGSAVRGKKKGRYVDVMAK*
Coding >Pro_DTO377G3_2|g6963.t1
ATGGCGCACCAAGCGACCGAGAATGATTCGGAGTCATGGAATCCGGCATCACGGCCCGATAACAATAATTCCCCT
GTTACGATCCAGAGTGGGTTGTCGGACCCGATTGCGGCGGACGGGCCAAAGGACAGGTCACTAGACGATGTTGTA
TCGCCACAGAGTGAGGATTTCTCTGCGTGGGATATATCCGATGAGGTAGATGGGATTCAGCCTCAATACACGAGC
TTAGACGTGCTAGTGAACAATGAATCACCAGTGGTGGACCAGGATATGTGCCTAGACACCGATTCCGTCGATAAG
AGCAGTCATGTCCCCGATGAGACGATCGCAGCGACTCATACAACTACGCCATCTATTGAAAATGCAGATACCGTC
CTAAGCCAGACACTGCCAAAAACTCAACCCGCGCAACCAGTTCAGATTGAAGCACCTTCAGTCCATGGCGCGGAG
ACCAGTAATAGCTTTCCCACCATCATAAACGGGTTTCCTTCTGTTCATACCGAAAACTCAGATACTGTTGTGCCC
ACTGTCGCACCTGAACAAGAAACAGCGCCGGAGTCGACGTTTGTGGGAGAGACTACACCTCCAAGAGAGGAAACA
ACGGCATCCGAGCCTACATTGGACACTTCTAAAAATAAATATACCTCTCAGTCCACTCCCACCGACGAACTGTTC
CCGGGAACGGACGCAGACAATGCCGATTCTGAAAATCCCTGGGCCACCTTCGAGAAGGACCTGAGCAATACGCTG
CCCTCCACCGAAGAGGCCACCCCTCATAATATCTCAGAGCTCGCCTCAACCTCTACTCAAATCCAGGATAGCGAC
GAGCCAAATTTTGTTGAAGAAGCTGTACGTCCATTGCCAGAGGAAACAGCATTCACAGGTGCCACACGTGATGCG
GAGAGTCTTGATGTCTTCAACTCAACTGAAAATGCCATCGCCCCGACCGAAAATGAGCAAATTGATCTCGTGTCT
CACTCGATAAATGTTGAATCTGGGAATACCGGATCACCATCTCCTATCGCGGAGGCCTTTGCGCCGACCAACGAC
GCCCATCTAGATCCGGCCGCAGCGGGCGTGGATACAACCACACAGGATCAACCTTTCTGGGCAAACGAGTCAAGC
GGTGAAGTGGAGTCCGATGAGGACGGCTTTTTTGACCAACTGAACAGCCAGACAAAGCCTATCTTTGCCCCGCCA
GAAGCTGAATCCAGGTTTGAGGAAGGGGTTCCGTTGTTAGATGAGTCTACACCGGCTTCGCCTCAACACCCAACG
GAACAGGAGACATCAATAGACAGTGTGTTTGCCAACGATGAAGACGATGTAGATGACTTCTTCATCTCGGCTCCA
AAGACAGAGGCTAAGAACGCCGATGAGGATTTCTTCGCCTCCACCCCAAAGAAAGAGCCCGAGGAGCAACCCGTT
GTTCATATCGCACGAAAGAGCACATCTCAGGTCTTGGAATCAGCCGGGTTTGCTCTCGATTCCCCGGTTAGTGAC
ACTTCGGCCGCAGCGCAGTTTGATGATGCCCTGAAGGCTGCGTCGTTGGAGCCCCAAACAATGGCCGATCCATCG
GAGGAGGAGCTAGCGGCACGGTGGGAAGCTGAACTCGGTGACTCACTGGACGATGATCTGGCGGCTCGTTGGGAG
GCGGCATTGGACGATGACGACATACTGCTGGAGACTGAAGCTGCCCAGTCTGTCTCTGAACAGGAGCACGCTCAT
CAAACCCCTGTTCAGCCTGTCAACGACGGTTTGGTGGTTGGCTTGAACAGTCCGTTCCAGACCCCACAAGTCTTT
TCTCAGCCAAGACCTGTTCCTAATATATACACACCCCACCAACCGTCCACTGGTGATCTTTTGCAGAATATTCCT
CTCCCAGGAACTGCGCCGCCAACCACGGGAGCGATGTCATCATACTTCTCGCAACAGCCGCAGAACCCCGTGGCA
ATCAGGGGAGAGAGCTTTGCTGAGCGGTCAAAAGAGGGTTATAAATCTCCTTACGACCTTCCAGATGATATCTCC
CGACCCCGAAAGCCGGTCGTTACCCACAAACCTGTTCCTCCACCAGTAATTAGTATGCCACCGCCTCCTCTTCCA
TGTGCCTCTGGCATACCGATTCCTGCTGTAGCTGGCTTCCCCCCTCCGGCAGCTCCCCCCTCAGCCCTGGCCGCT
CCTCCTGCGCCGAAGAATTTCTATGAGGAACTCCCTCTGCCGCCACCAAGATCTAGGCCTGCCAGCTCAGGTCGG
TACACCCCTAATCCGCAGACGGCGCCGACGATGACCGGATCGTCTCTTCCTCCTCCCCAGGTTCAATATGCTTCT
GTTGTACCACCAGCCCCACAACCTATCGGGCTCCCAATCCAATCCACACTTCAGCCACCTGAACAGCTGGATCCA
TATGCTAGCCTGTCATCGAGTGCCCCGGTCGGACCTCCTACCGTTGCAAGGTACTCTCCTCAACCTCCTGGTTTT
CAAGCACCCCCAAAGCCACCTTCGTTGCCGAGATATTCGCCTGCGCCCCCTCCTACCTCTTCTGTTCGCAATCGT
TATGCCTCACAGCCGCTTAACGTTCCTGGCCAAAATTTGCCTTTCCAGCCACGGACTTCAAGTCCTCTTGCACAC
CATGAAAAGGTTTCTTACCAGCCTGATCAATCACACAGGCCCCCATCGCTTGAGCCTGCGATCAACCTTTCTTCG
CCGCGCGAGCAAGGAGCTGGTTTCGGACAAATCCCACCTAGTGCTCCGCAATATTTCAACGGTCCTGCCAACCTA
CCGCGGAGAGAAAGTGCGGGCTCACCTCTCCAGCCATCTCCGCCTCAAAGTCGCTATGCCCCTCAGGAATATCTC
AATGAATTCGCTCAGCGTCTTGCGCCGGGTCCAGAACACGCTCCTCCTGCTCCTCCTGCTCCCCCGGCCAATGGA
TTGTCTCCACCACCTAGCGATTTCCAAATGGGTCCACTTCGCAGATCTCAGACTCAGTCACCTGCCCGGGACTTG
ACGAGCCCGCGATCCTACGGACAAGACATCGATCCCCTCCAACGGCCGGCTTCGGTGCAAGTTTCAAGCTTGCCA
ATTCAAACCGTGAATCCGTATGCTCCTGTGAAGCCTGTTCATCAAACCCGTGCTCCGACGCATCATCTGGAATTT
ATCGCTCCCAATGATGGGCAGGAGCATGATCCCTTGGAACGATGGAAAGGTGCTCCGATCTTCAAATTCGGGTTC
GGTGGATCCATGGTATCTTGTTTTCCCAAGCACGTCCCTCGCTATTCCATTGGACAAGTGGCGCCAATGATTCAA
CCCACTCTTGGTGAACCGAAAATCTCCCAGCTGAGCGAGTGGCTGCCCTCCGCTGATACCATTGTCCAGCACCCT
GGGCCTCTCAAGGCAAAGTCAAAGAAGAAGGATTTGGTTGCTTGGCTTTCTAGCAAGATTGCAGCATTCGAAAAT
TCAGACCTTCCAAGCTACGAACAGGTTCAGTCTGATACGCACAAACGCCAGGAGGAGAAAACCCTTCTCTGGAAA
GTTGTGAAGCTTCTGGTAGAGAATGACGGTAATCTGGAGAGTTCCCCTGAAATTCAAACCTCTCTCCGACATATC
ATCTTCCCCAACCTACCCAACTCCGACGCAGACGGATCATACGCAAGCAGCTTAGCCCCCTCGGGAGGGGTTGCC
CCTTCGGAAACGCCTTTGCAGGCTGATGCTGTTGATGCACAGTGGTTGGAAGAGCTTCGACTACACTTAATATGT
GGCGATCGAGAGAAGGCCGTGTGGAGCGCTGTCGATCGACGTCTTTGGGGACATGCGATGATCATCTCATCCACC
ATGGACAGGTCAATATCGAAACAGGTCGCGCAGGAGTTTGTCCGCCGCGAGGTCCGATCGAAATCCGCAAACACC
GAGTCACTTGCAGCCCTCTACGAGATTTTCGCTGGCAATATCGAAGAAAGCATCGACGAACTCGTTGCCCCGTCT
GCCCGGGCAGGTCTGCAACTTATTAGCATGGCCAATGGCCAGGGGTCTACCAAAAATGCCCTCGAGGGTTTAGAC
AAATGGAGGGATACCTTGGGACTGGTTTTGAGTAACCGAAGTCCTGGGGACCACCAAGCCCTTTTTTCTCTTGGA
CATCTGCTTAGTTCTTATGGACGGACGGAGGCAGCTCACGTTTGTTACATCTTCTCGCGCGCTGCCGTTTTCGGT
GGCCCGGATGATCCACAGGCCAACATCACTCTCCTTGGTGCTGACCATCAGCGTTGCCCTTCTTCCTTGATGGAT
GAAGATGCTATCTTGCTGACCGAGGCCTATGAGTTTGCTATGTCTGTTCTCGGCAACTCTCCCACAGCTCATCTG
CCACATCTGTTGGCATTTAAGATACTGAATGCCAGGTGCCTCGTAGACCAGGGTCGCAATTTAGAGGCGCAAGGC
TATTGCGACGCAGTGGCAGCGGCATTGAAAGCAACCACTCGTCCCTCGCCCTACTATCACCAACACCTCTTTGCG
GAAGTTGAAGAGTTGTCTGCTCGTCTGCGCCAAACAACCAGCGACAGTGGCTCTTGGATCTCGAGACCAAGCATG
GAAAAGGTCTCGGGGTCTATGTGGGCTCGTTTCAATAGCTTCGTGGTAGGCGATGATAGCGATGCTGCATCGACT
GGATCCGGCAAGGGTGGCGAGCATGCGGAGTTTGGTCCTTTTGCAAACGTGGCCGGCACCCCAACAATTAGCCGC
TCACCTTCTGTATCTGAAATATACGGCTCTTATCCTGGAGCCGCGGCTGGAGCGCCGCTTATTCCTACCAGCGGC
GCGTCCAAGTATCACCCATCGAGCCAATATGCGCCTGGTGCCTCACCTGAGCAGTTCAAGGGCCGATCGTCAATA
GATTCTCAGAGATCTGCTTCCTACTTCCCACCCTATGGACAACGCCGAAGCTCACAGGAACTCTCGCCCTCGATT
GATCAACAGATGTCCTATGGAGCTCCAGGGTATGGGTCGCCAAGCGCGGGTGGGTATCAACCAACACCACCTCAA
TCCTCTTATATTCCTCTTGCTCCGGTAGAAGAAGCTACGTCACCGGCTGAAGCTCATCCGGCTGCACAGTCTATG
GTGAATGGTCTCTTTTACCATCCTCCTGGCCAGGCTGCCACATCCAGCCAATCCCCATATTATCAAGGCCCTCCT
GGTATGCCAGCCAGTGTACCAGACTCAGAGTCACCCTACGCACCTCCCGCTGCCAGCTCATCTTATGAGCCGGTC
TCTTATGAGCCAAATTCTTACGAGCCAGCTGCGGCTGGTGTAGACATGGGCTATGGTTCCCAGGAGGAGGACCTG
CCACGGGCCGCGGAGCAGCCAAGGAAGCAGTCGATCATGGATGACGACGACGACGATCTTGCTGCCCGGGCAGCG
GCTATCCAAAAAGCGGAGAATGATCGCAAGGCCAACGAAGCGTTCGCAAAAGCCGCCGAGGAAGATGCTAAAAAG
GGTCCCCAACAATCTGGCAAGAAGGGCTGGTTTGGTGGTTGGTTCGGCGGAGCTAAGAAAGAAGAAAACTCCGGT
GGCGGTCCTATCAGAGCTAAACTTGGCGAAGAGAGCTCCTTTTACTACGACAAGGAACTGAAGAAATGGGTCAAC
AAGAAAGACCCCGGTAGTAGCGCGCCTGTGCATGCCACCCCGCCCCCTCCTCGAAGATCCGCTCCCCCCAGTCGG
ACTGCGAGCTCAAATAGTATGCCCCAAAACGGTGCGCCCCCGATGCCCCCGATGCCCCCAATGTCGGTCTCTGGT
GGCCGGCCTCAATCTTCCTCTACCGCCGCACCGCCTTTCTTGTCCCCCAGCCCAGGCTTCCCTGGTCTCGCGCCT
CGGTCCGTTTCTACGGGAGCGGCCATGCCAACACCGCCCGGTAGTTCCAGTGGCCCGCCGCCACGGCCTTCTTCG
TCCTTGACTCATGCTAGCTCAATTGACGATTTGATCGGTGCGCCTCAGGCGCGCAAGGGCAGCGCAGTTCGCGGC
AAGAAGAAGGGACGCTACGTTGACGTGATGGCTAAATAA
Transcript >Pro_DTO377G3_2|g6963.t1
ATGGCGCACCAAGCGACCGAGAATGATTCGGAGTCATGGAATCCGGCATCACGGCCCGATAACAATAATTCCCCT
GTTACGATCCAGAGTGGGTTGTCGGACCCGATTGCGGCGGACGGGCCAAAGGACAGGTCACTAGACGATGTTGTA
TCGCCACAGAGTGAGGATTTCTCTGCGTGGGATATATCCGATGAGGTAGATGGGATTCAGCCTCAATACACGAGC
TTAGACGTGCTAGTGAACAATGAATCACCAGTGGTGGACCAGGATATGTGCCTAGACACCGATTCCGTCGATAAG
AGCAGTCATGTCCCCGATGAGACGATCGCAGCGACTCATACAACTACGCCATCTATTGAAAATGCAGATACCGTC
CTAAGCCAGACACTGCCAAAAACTCAACCCGCGCAACCAGTTCAGATTGAAGCACCTTCAGTCCATGGCGCGGAG
ACCAGTAATAGCTTTCCCACCATCATAAACGGGTTTCCTTCTGTTCATACCGAAAACTCAGATACTGTTGTGCCC
ACTGTCGCACCTGAACAAGAAACAGCGCCGGAGTCGACGTTTGTGGGAGAGACTACACCTCCAAGAGAGGAAACA
ACGGCATCCGAGCCTACATTGGACACTTCTAAAAATAAATATACCTCTCAGTCCACTCCCACCGACGAACTGTTC
CCGGGAACGGACGCAGACAATGCCGATTCTGAAAATCCCTGGGCCACCTTCGAGAAGGACCTGAGCAATACGCTG
CCCTCCACCGAAGAGGCCACCCCTCATAATATCTCAGAGCTCGCCTCAACCTCTACTCAAATCCAGGATAGCGAC
GAGCCAAATTTTGTTGAAGAAGCTGTACGTCCATTGCCAGAGGAAACAGCATTCACAGGTGCCACACGTGATGCG
GAGAGTCTTGATGTCTTCAACTCAACTGAAAATGCCATCGCCCCGACCGAAAATGAGCAAATTGATCTCGTGTCT
CACTCGATAAATGTTGAATCTGGGAATACCGGATCACCATCTCCTATCGCGGAGGCCTTTGCGCCGACCAACGAC
GCCCATCTAGATCCGGCCGCAGCGGGCGTGGATACAACCACACAGGATCAACCTTTCTGGGCAAACGAGTCAAGC
GGTGAAGTGGAGTCCGATGAGGACGGCTTTTTTGACCAACTGAACAGCCAGACAAAGCCTATCTTTGCCCCGCCA
GAAGCTGAATCCAGGTTTGAGGAAGGGGTTCCGTTGTTAGATGAGTCTACACCGGCTTCGCCTCAACACCCAACG
GAACAGGAGACATCAATAGACAGTGTGTTTGCCAACGATGAAGACGATGTAGATGACTTCTTCATCTCGGCTCCA
AAGACAGAGGCTAAGAACGCCGATGAGGATTTCTTCGCCTCCACCCCAAAGAAAGAGCCCGAGGAGCAACCCGTT
GTTCATATCGCACGAAAGAGCACATCTCAGGTCTTGGAATCAGCCGGGTTTGCTCTCGATTCCCCGGTTAGTGAC
ACTTCGGCCGCAGCGCAGTTTGATGATGCCCTGAAGGCTGCGTCGTTGGAGCCCCAAACAATGGCCGATCCATCG
GAGGAGGAGCTAGCGGCACGGTGGGAAGCTGAACTCGGTGACTCACTGGACGATGATCTGGCGGCTCGTTGGGAG
GCGGCATTGGACGATGACGACATACTGCTGGAGACTGAAGCTGCCCAGTCTGTCTCTGAACAGGAGCACGCTCAT
CAAACCCCTGTTCAGCCTGTCAACGACGGTTTGGTGGTTGGCTTGAACAGTCCGTTCCAGACCCCACAAGTCTTT
TCTCAGCCAAGACCTGTTCCTAATATATACACACCCCACCAACCGTCCACTGGTGATCTTTTGCAGAATATTCCT
CTCCCAGGAACTGCGCCGCCAACCACGGGAGCGATGTCATCATACTTCTCGCAACAGCCGCAGAACCCCGTGGCA
ATCAGGGGAGAGAGCTTTGCTGAGCGGTCAAAAGAGGGTTATAAATCTCCTTACGACCTTCCAGATGATATCTCC
CGACCCCGAAAGCCGGTCGTTACCCACAAACCTGTTCCTCCACCAGTAATTAGTATGCCACCGCCTCCTCTTCCA
TGTGCCTCTGGCATACCGATTCCTGCTGTAGCTGGCTTCCCCCCTCCGGCAGCTCCCCCCTCAGCCCTGGCCGCT
CCTCCTGCGCCGAAGAATTTCTATGAGGAACTCCCTCTGCCGCCACCAAGATCTAGGCCTGCCAGCTCAGGTCGG
TACACCCCTAATCCGCAGACGGCGCCGACGATGACCGGATCGTCTCTTCCTCCTCCCCAGGTTCAATATGCTTCT
GTTGTACCACCAGCCCCACAACCTATCGGGCTCCCAATCCAATCCACACTTCAGCCACCTGAACAGCTGGATCCA
TATGCTAGCCTGTCATCGAGTGCCCCGGTCGGACCTCCTACCGTTGCAAGGTACTCTCCTCAACCTCCTGGTTTT
CAAGCACCCCCAAAGCCACCTTCGTTGCCGAGATATTCGCCTGCGCCCCCTCCTACCTCTTCTGTTCGCAATCGT
TATGCCTCACAGCCGCTTAACGTTCCTGGCCAAAATTTGCCTTTCCAGCCACGGACTTCAAGTCCTCTTGCACAC
CATGAAAAGGTTTCTTACCAGCCTGATCAATCACACAGGCCCCCATCGCTTGAGCCTGCGATCAACCTTTCTTCG
CCGCGCGAGCAAGGAGCTGGTTTCGGACAAATCCCACCTAGTGCTCCGCAATATTTCAACGGTCCTGCCAACCTA
CCGCGGAGAGAAAGTGCGGGCTCACCTCTCCAGCCATCTCCGCCTCAAAGTCGCTATGCCCCTCAGGAATATCTC
AATGAATTCGCTCAGCGTCTTGCGCCGGGTCCAGAACACGCTCCTCCTGCTCCTCCTGCTCCCCCGGCCAATGGA
TTGTCTCCACCACCTAGCGATTTCCAAATGGGTCCACTTCGCAGATCTCAGACTCAGTCACCTGCCCGGGACTTG
ACGAGCCCGCGATCCTACGGACAAGACATCGATCCCCTCCAACGGCCGGCTTCGGTGCAAGTTTCAAGCTTGCCA
ATTCAAACCGTGAATCCGTATGCTCCTGTGAAGCCTGTTCATCAAACCCGTGCTCCGACGCATCATCTGGAATTT
ATCGCTCCCAATGATGGGCAGGAGCATGATCCCTTGGAACGATGGAAAGGTGCTCCGATCTTCAAATTCGGGTTC
GGTGGATCCATGGTATCTTGTTTTCCCAAGCACGTCCCTCGCTATTCCATTGGACAAGTGGCGCCAATGATTCAA
CCCACTCTTGGTGAACCGAAAATCTCCCAGCTGAGCGAGTGGCTGCCCTCCGCTGATACCATTGTCCAGCACCCT
GGGCCTCTCAAGGCAAAGTCAAAGAAGAAGGATTTGGTTGCTTGGCTTTCTAGCAAGATTGCAGCATTCGAAAAT
TCAGACCTTCCAAGCTACGAACAGGTTCAGTCTGATACGCACAAACGCCAGGAGGAGAAAACCCTTCTCTGGAAA
GTTGTGAAGCTTCTGGTAGAGAATGACGGTAATCTGGAGAGTTCCCCTGAAATTCAAACCTCTCTCCGACATATC
ATCTTCCCCAACCTACCCAACTCCGACGCAGACGGATCATACGCAAGCAGCTTAGCCCCCTCGGGAGGGGTTGCC
CCTTCGGAAACGCCTTTGCAGGCTGATGCTGTTGATGCACAGTGGTTGGAAGAGCTTCGACTACACTTAATATGT
GGCGATCGAGAGAAGGCCGTGTGGAGCGCTGTCGATCGACGTCTTTGGGGACATGCGATGATCATCTCATCCACC
ATGGACAGGTCAATATCGAAACAGGTCGCGCAGGAGTTTGTCCGCCGCGAGGTCCGATCGAAATCCGCAAACACC
GAGTCACTTGCAGCCCTCTACGAGATTTTCGCTGGCAATATCGAAGAAAGCATCGACGAACTCGTTGCCCCGTCT
GCCCGGGCAGGTCTGCAACTTATTAGCATGGCCAATGGCCAGGGGTCTACCAAAAATGCCCTCGAGGGTTTAGAC
AAATGGAGGGATACCTTGGGACTGGTTTTGAGTAACCGAAGTCCTGGGGACCACCAAGCCCTTTTTTCTCTTGGA
CATCTGCTTAGTTCTTATGGACGGACGGAGGCAGCTCACGTTTGTTACATCTTCTCGCGCGCTGCCGTTTTCGGT
GGCCCGGATGATCCACAGGCCAACATCACTCTCCTTGGTGCTGACCATCAGCGTTGCCCTTCTTCCTTGATGGAT
GAAGATGCTATCTTGCTGACCGAGGCCTATGAGTTTGCTATGTCTGTTCTCGGCAACTCTCCCACAGCTCATCTG
CCACATCTGTTGGCATTTAAGATACTGAATGCCAGGTGCCTCGTAGACCAGGGTCGCAATTTAGAGGCGCAAGGC
TATTGCGACGCAGTGGCAGCGGCATTGAAAGCAACCACTCGTCCCTCGCCCTACTATCACCAACACCTCTTTGCG
GAAGTTGAAGAGTTGTCTGCTCGTCTGCGCCAAACAACCAGCGACAGTGGCTCTTGGATCTCGAGACCAAGCATG
GAAAAGGTCTCGGGGTCTATGTGGGCTCGTTTCAATAGCTTCGTGGTAGGCGATGATAGCGATGCTGCATCGACT
GGATCCGGCAAGGGTGGCGAGCATGCGGAGTTTGGTCCTTTTGCAAACGTGGCCGGCACCCCAACAATTAGCCGC
TCACCTTCTGTATCTGAAATATACGGCTCTTATCCTGGAGCCGCGGCTGGAGCGCCGCTTATTCCTACCAGCGGC
GCGTCCAAGTATCACCCATCGAGCCAATATGCGCCTGGTGCCTCACCTGAGCAGTTCAAGGGCCGATCGTCAATA
GATTCTCAGAGATCTGCTTCCTACTTCCCACCCTATGGACAACGCCGAAGCTCACAGGAACTCTCGCCCTCGATT
GATCAACAGATGTCCTATGGAGCTCCAGGGTATGGGTCGCCAAGCGCGGGTGGGTATCAACCAACACCACCTCAA
TCCTCTTATATTCCTCTTGCTCCGGTAGAAGAAGCTACGTCACCGGCTGAAGCTCATCCGGCTGCACAGTCTATG
GTGAATGGTCTCTTTTACCATCCTCCTGGCCAGGCTGCCACATCCAGCCAATCCCCATATTATCAAGGCCCTCCT
GGTATGCCAGCCAGTGTACCAGACTCAGAGTCACCCTACGCACCTCCCGCTGCCAGCTCATCTTATGAGCCGGTC
TCTTATGAGCCAAATTCTTACGAGCCAGCTGCGGCTGGTGTAGACATGGGCTATGGTTCCCAGGAGGAGGACCTG
CCACGGGCCGCGGAGCAGCCAAGGAAGCAGTCGATCATGGATGACGACGACGACGATCTTGCTGCCCGGGCAGCG
GCTATCCAAAAAGCGGAGAATGATCGCAAGGCCAACGAAGCGTTCGCAAAAGCCGCCGAGGAAGATGCTAAAAAG
GGTCCCCAACAATCTGGCAAGAAGGGCTGGTTTGGTGGTTGGTTCGGCGGAGCTAAGAAAGAAGAAAACTCCGGT
GGCGGTCCTATCAGAGCTAAACTTGGCGAAGAGAGCTCCTTTTACTACGACAAGGAACTGAAGAAATGGGTCAAC
AAGAAAGACCCCGGTAGTAGCGCGCCTGTGCATGCCACCCCGCCCCCTCCTCGAAGATCCGCTCCCCCCAGTCGG
ACTGCGAGCTCAAATAGTATGCCCCAAAACGGTGCGCCCCCGATGCCCCCGATGCCCCCAATGTCGGTCTCTGGT
GGCCGGCCTCAATCTTCCTCTACCGCCGCACCGCCTTTCTTGTCCCCCAGCCCAGGCTTCCCTGGTCTCGCGCCT
CGGTCCGTTTCTACGGGAGCGGCCATGCCAACACCGCCCGGTAGTTCCAGTGGCCCGCCGCCACGGCCTTCTTCG
TCCTTGACTCATGCTAGCTCAATTGACGATTTGATCGGTGCGCCTCAGGCGCGCAAGGGCAGCGCAGTTCGCGGC
AAGAAGAAGGGACGCTACGTTGACGTGATGGCTAAATAA
Gene >Pro_DTO377G3_2|g6963.t1
ATGGCGCACCAAGCGACCGAGAATGATTCGGAGTCATGGAATCCGGCATCACGGCCCGATAACAATAATTCCCCT
GTTACGATCCAGAGTGGGTTGTCGGACCCGATTGCGGCGGACGGGCCAAAGGACAGGTCACTAGACGATGTTGTA
TCGCCACAGAGTGAGGATTTCTCTGCGTGGGATATATCCGATGAGGTAGATGGGATTCAGCCTCAATACACGAGC
TTAGACGTGCTAGTGAACAATGAATCACCAGTGGTGGACCAGGATATGTGCCTAGACACCGATTCCGTCGATAAG
AGCAGTCATGTCCCCGATGAGACGATCGCAGCGACTCATACAACTACGCCATCTATTGAAAATGCAGATACCGTC
CTAAGCCAGACACTGCCAAAAACTCAACCCGCGCAACCAGTTCAGATTGAAGCACCTTCAGTCCATGGCGCGGAG
ACCAGTAATAGCTTTCCCACCATCATAAACGGGTTTCCTTCTGTTCATACCGAAAACTCAGATACTGTTGTGCCC
ACTGTCGCACCTGAACAAGAAACAGCGCCGGAGTCGACGTTTGTGGGAGAGACTACACCTCCAAGAGAGGAAACA
ACGGCATCCGAGCCTACATTGGACACTTCTAAAAATAAATATACCTCTCAGTCCACTCCCACCGACGAACTGTTC
CCGGGAACGGACGCAGACAATGCCGATTCTGAAAATCCCTGGGCCACCTTCGAGAAGGACCTGAGCAATACGCTG
CCCTCCACCGAAGAGGCCACCCCTCATAATATCTCAGAGCTCGCCTCAACCTCTACTCAAATCCAGGATAGCGAC
GAGCCAAATTTTGTTGAAGAAGCTGTACGTCCATTGCCAGAGGAAACAGCATTCACAGGTGCCACACGTGATGCG
GAGAGTCTTGATGTCTTCAACTCAACTGAAAATGCCATCGCCCCGACCGAAAATGAGCAAATTGATCTCGTGTCT
CACTCGATAAATGTTGAATCTGGGAATACCGGATCACCATCTCCTATCGCGGAGGCCTTTGCGCCGACCAACGAC
GCCCATCTAGATCCGGCCGCAGCGGGCGTGGATACAACCACACAGGATCAACCTTTCTGGGCAAACGAGTCAAGC
GGTGAAGTGGAGTCCGATGAGGACGGCTTTTTTGACCAACTGAACAGCCAGACAAAGCCTATCTTTGCCCCGCCA
GAAGCTGAATCCAGGTTTGAGGAAGGGGTTCCGTTGTTAGATGAGTCTACACCGGCTTCGCCTCAACACCCAACG
GAACAGGAGACATCAATAGACAGTGTGTTTGCCAACGATGAAGACGATGTAGATGACTTCTTCATCTCGGCTCCA
AAGACAGAGGCTAAGAACGCCGATGAGGATTTCTTCGCCTCCACCCCAAAGAAAGAGCCCGAGGAGCAACCCGTT
GTTCATATCGCACGAAAGAGCACATCTCAGGTCTTGGAATCAGCCGGGTTTGCTCTCGATTCCCCGGTTAGTGAC
ACTTCGGCCGCAGCGCAGTTTGATGATGCCCTGAAGGCTGCGTCGTTGGAGCCCCAAACAATGGCCGATCCATCG
GAGGAGGAGCTAGCGGCACGGTGGGAAGCTGAACTCGGTGACTCACTGGACGATGATCTGGCGGCTCGTTGGGAG
GCGGCATTGGACGATGACGACATACTGCTGGAGACTGAAGCTGCCCAGTCTGTCTCTGAACAGGAGCACGCTCAT
CAAACCCCTGTTCAGCCTGTCAACGACGGTTTGGTGGTTGGCTTGAACAGTCCGTTCCAGACCCCACAAGTCTTT
TCTCAGCCAAGACCTGTTCCTAATATATACACACCCCACCAACCGTCCACTGGTGATCTTTTGCAGAATATTCCT
CTCCCAGGAACTGCGCCGCCAACCACGGGAGCGATGTCATCATACTTCTCGCAACAGCCGCAGAACCCCGTGGCA
ATCAGGGGAGAGAGCTTTGCTGAGCGGTCAAAAGAGGGTTATAAATCTCCTTACGACCTTCCAGATGATATCTCC
CGACCCCGAAAGCCGGTCGTTACCCACAAACCTGTTCCTCCACCAGTAATTAGTATGCCACCGCCTCCTCTTCCA
TGTGCCTCTGGCATACCGATTCCTGCTGTAGCTGGCTTCCCCCCTCCGGCAGCTCCCCCCTCAGCCCTGGCCGCT
CCTCCTGCGCCGAAGAATTTCTATGAGGAACTCCCTCTGCCGCCACCAAGATCTAGGCCTGCCAGCTCAGGTCGG
TACACCCCTAATCCGCAGACGGCGCCGACGATGACCGGATCGTCTCTTCCTCCTCCCCAGGTTCAATATGCTTCT
GTTGTACCACCAGCCCCACAACCTATCGGGCTCCCAATCCAATCCACACTTCAGCCACCTGAACAGCTGGATCCA
TATGCTAGCCTGTCATCGAGTGCCCCGGTCGGACCTCCTACCGTTGCAAGGTACTCTCCTCAACCTCCTGGTTTT
CAAGCACCCCCAAAGCCACCTTCGTTGCCGAGATATTCGCCTGCGCCCCCTCCTACCTCTTCTGTTCGCAATCGT
TATGCCTCACAGCCGCTTAACGTTCCTGGCCAAAATTTGCCTTTCCAGCCACGGACTTCAAGTCCTCTTGCACAC
CATGAAAAGGTTTCTTACCAGCCTGATCAATCACACAGGCCCCCATCGCTTGAGCCTGCGATCAACCTTTCTTCG
CCGCGCGAGCAAGGAGCTGGTTTCGGACAAATCCCACCTAGTGCTCCGCAATATTTCAACGGTCCTGCCAACCTA
CCGCGGAGAGAAAGTGCGGGCTCACCTCTCCAGCCATCTCCGCCTCAAAGTCGCTATGCCCCTCAGGAATATCTC
AATGAATTCGCTCAGCGTCTTGCGCCGGGTCCAGAACACGCTCCTCCTGCTCCTCCTGCTCCCCCGGCCAATGGA
TTGTCTCCACCACCTAGCGATTTCCAAATGGGTCCACTTCGCAGATCTCAGACTCAGTCACCTGCCCGGGACTTG
ACGAGCCCGCGATCCTACGGACAAGACATCGATCCCCTCCAACGGCCGGCTTCGGTGCAAGTTTCAAGCTTGCCA
ATTCAAACCGTGAATCCGTATGCTCCTGTGAAGCCTGTTCATCAAACCCGTGCTCCGACGCATCATCTGGAATTT
ATCGCTCCCAATGATGGGCAGGAGCATGATCCCTTGGAACGATGGAAAGGTGCTCCGATCTTCAAATTCGGGTTC
GGTGGATCCATGGTATCTTGTTTTCCCAAGCACGTCCCTCGCTATTCCATTGGACAAGTGGCGCCAATGATTCAA
CCCACTCTTGGTGAACCGAAAATCTCCCAGCTGAGCGAGTGGCTGCCCTCCGCTGATACCATTGTCCAGCACCCT
GGGCCTCTCAAGGCAAAGTCAAAGAAGAAGGATTTGGTTGCTTGGCTTTCTAGCAAGATTGCAGCATTCGAAAAT
TCAGACCTTCCAAGCTACGAACAGGTTCAGTCTGATACGCACAAACGCCAGGAGGAGAAAACCCTTCTCTGGAAA
GTTGTGAAGCTTCTGGTAGAGAATGACGGTAATCTGGAGAGTTCCCCTGAAATTCAAACCTCTCTCCGACATATC
ATCTTCCCCAACCTACCCAACTCCGACGCAGACGGATCATACGCAAGCAGCTTAGCCCCCTCGGGAGGGGTTGCC
CCTTCGGAAACGCCTTTGCAGGCTGATGCTGTTGATGCACAGTGGTTGGAAGAGCTTCGACTACACTTAATATGT
GGCGATCGAGAGAAGGCCGTGTGGAGCGCTGTCGATCGACGTCTTTGGGGACATGCGATGATCATCTCATCCACC
ATGGACAGGTCAATATCGAAACAGGTCGCGCAGGAGTTTGTCCGCCGCGAGGTCCGATCGAAATCCGCAAACACC
GAGTCACTTGCAGCCCTCTACGAGATTTTCGCTGGCAATATCGAAGAAAGCATCGACGAACTCGTTGCCCCGTCT
GCCCGGGCAGGTCTGCAACTTATTAGCATGGCCAATGGCCAGGGGTCTACCAAAAATGCCCTCGAGGGTTTAGAC
AAATGGAGGGATACCTTGGGACTGGTTTTGAGTAACCGAAGTCCTGGGGACCACCAAGCCCTTTTTTCTCTTGGA
CATCTGCTTAGTTCTTATGGACGGACGGAGGCAGCTCACGTTTGTTACATCTTCTCGCGCGCTGCCGTTTTCGGT
GGCCCGGATGATCCACAGGCCAACATCACTCTCCTTGGTGCTGACCATCAGCGTTGCCCTTCTTCCTTGATGGAT
GAAGATGCTATCTTGCTGACCGAGGCCTATGAGTTTGCTATGTCTGTTCTCGGCAACTCTCCCACAGCTCATCTG
CCACATCTGTTGGCATTTAAGATACTGAATGCCAGGTGCCTCGTAGACCAGGGTCGCAATTTAGAGGCGCAAGGC
TATTGCGACGCAGTGGCAGCGGCATTGAAAGCAACCACTCGTCCCTCGCCCTACTATCACCAACACCTCTTTGCG
GAAGTTGAAGAGTTGTCTGCTCGTCTGCGCCAAACAACCAGCGACAGTGGCTCTTGGATCTCGAGACCAAGCATG
GAAAAGGTCTCGGGGTCTATGTGGGCTCGTTTCAATAGCTTCGTGGTAGGCGATGATAGCGATGCTGCATCGACT
GGATCCGGCAAGGGTGGCGAGCATGCGGAGTTTGGTCCTTTTGCAAACGTGGCCGGCACCCCAACAATTAGCCGC
TCACCTTCTGTATCTGAAATATACGGCTCTTATCCTGGAGCCGCGGCTGGAGCGCCGCTTATTCCTACCAGCGGC
GCGTCCAAGTATCACCCATCGAGCCAATATGCGCCTGGTGCCTCACCTGAGCAGTTCAAGGGCCGATCGTCAATA
GATTCTCAGAGATCTGCTTCCTACTTCCCACCCTATGGACAACGCCGAAGCTCACAGGAACTCTCGCCCTCGATT
GATCAACAGATGTCCTATGGAGCTCCAGGGTATGGGTCGCCAAGCGCGGGTGGGTATCAACCAACACCACCTCAA
TCCTCTTATATTCCTCTTGCTCCGGTAGAAGAAGCTACGTCACCGGCTGAAGCTCATCCGGCTGCACAGTCTATG
GTGAATGGTCTCTTTTACCATCCTCCTGGCCAGGCTGCCACATCCAGCCAATCCCCATATTATCAAGGCCCTCCT
GGTATGCCAGCCAGTGTACCAGACTCAGAGTCACCCTACGCACCTCCCGCTGCCAGCTCATCTTATGAGCCGGTC
TCTTATGAGCCAAATTCTTACGAGCCAGCTGCGGCTGGTGTAGACATGGGCTATGGTTCCCAGGAGGAGGACCTG
CCACGGGCCGCGGAGCAGCCAAGGAAGCAGTCGATCATGGATGACGACGACGACGATCTTGCTGCCCGGGCAGCG
GCTATCCAAAAAGCGGAGAATGATCGCAAGGCCAACGAAGCGTTCGCAAAAGCCGCCGAGGAAGATGGTATGTAT
TAGAAACGCCTATTGCTTATCTCACTTGCTAATCTGACTTGTGTTGCAGCTAAAAAGGGTCCCCAACAATCTGGC
AAGAAGGGCTGGTTTGGTGGTTGGTTCGGCGGAGCTAAGAAAGAAGAAAACTCCGGTGGCGGTCCTATCAGAGCT
AAACTTGGCGAAGAGAGCTCCTTTTACTACGACAAGGAACTGAAGAAATGGGTCAACAAGAAAGACCCCGGTAGT
AGCGCGCCTGTGCATGCCACCCCGCCCCCTCCTCGAAGATCCGCTCCCCCCAGTCGGACTGCGAGCTCAAATAGT
ATGCCCCAAAACGGTGCGCCCCCGATGCCCCCGATGCCCCCAATGTCGGTCTCTGGTGGCCGGCCTCAATCTTCC
TCTACCGCCGCACCGCCTTTCTTGTCCCCCAGCCCAGGCTTCCCTGGTCTCGCGCCTCGGTCCGTTTCTACGGGA
GCGGCCATGCCAACACCGCCCGGTAGTTCCAGTGGCCCGCCGCCACGGCCTTCTTCGTCCTTGACTCATGCTAGC
TCAATTGACGATTTGATCGGTGCGCCTCAGGCGCGCAAGGGCAGCGCAGTTCGCGGCAAGAAGAAGGGACGCTAC
GTTGACGTGATGGCTAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail