Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6952.t1
Gene name
Locationscaffold_20:53964..56020
Strand+
Gene length (bp)2056
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04086 SRP-alpha_N Signal recognition particle, alpha subunit, N-terminal 5.5E-77 26 305
PF00448 SRP54 SRP54-type protein, GTPase domain 1.8E-50 438 646
PF02881 SRP54_N SRP54-type protein, helical bundle domain 3.5E-08 333 399
PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB 2.2E-07 432 540

GO

GO Term Description Terminal node
GO:0005785 signal recognition particle receptor complex Yes
GO:0003924 GTPase activity Yes
GO:0005047 signal recognition particle binding Yes
GO:0006886 intracellular protein transport Yes
GO:0005525 GTP binding Yes
GO:0006614 SRP-dependent cotranslational protein targeting to membrane Yes
GO:0043021 ribonucleoprotein complex binding No
GO:0044446 intracellular organelle part No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016462 pyrophosphatase activity No
GO:0051649 establishment of localization in cell No
GO:0032553 ribonucleotide binding No
GO:0045184 establishment of protein localization No
GO:0001883 purine nucleoside binding No
GO:0003824 catalytic activity No
GO:0006613 cotranslational protein targeting to membrane No
GO:0071705 nitrogen compound transport No
GO:0072599 establishment of protein localization to endoplasmic reticulum No
GO:0072594 establishment of protein localization to organelle No
GO:0043168 anion binding No
GO:0001882 nucleoside binding No
GO:1901265 nucleoside phosphate binding No
GO:0071702 organic substance transport No
GO:0032549 ribonucleoside binding No
GO:0045047 protein targeting to ER No
GO:0044464 cell part No
GO:0051179 localization No
GO:0098796 membrane protein complex No
GO:0006605 protein targeting No
GO:1901363 heterocyclic compound binding No
GO:0070727 cellular macromolecule localization No
GO:0044444 cytoplasmic part No
GO:0042886 amide transport No
GO:0032555 purine ribonucleotide binding No
GO:0051641 cellular localization No
GO:0097159 organic cyclic compound binding No
GO:0051234 establishment of localization No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0008150 biological_process No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0044425 membrane part No
GO:0005488 binding No
GO:0044424 intracellular part No
GO:0033365 protein localization to organelle No
GO:0015031 protein transport No
GO:0034613 cellular protein localization No
GO:0044877 protein-containing complex binding No
GO:0019001 guanyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0044422 organelle part No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0032550 purine ribonucleoside binding No
GO:0006612 protein targeting to membrane No
GO:0032561 guanyl ribonucleotide binding No
GO:0016787 hydrolase activity No
GO:0090150 establishment of protein localization to membrane No
GO:0032991 protein-containing complex No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0044432 endoplasmic reticulum part No
GO:0070972 protein localization to endoplasmic reticulum No
GO:0033036 macromolecule localization No
GO:0097367 carbohydrate derivative binding No
GO:0015833 peptide transport No
GO:0017076 purine nucleotide binding No
GO:0072657 protein localization to membrane No
GO:0036094 small molecule binding No
GO:0017111 nucleoside-triphosphatase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6952.t1
MLEAFEILTTSGVVLWSKAYAPVGAHVINSLINDVFIEEKVVPQNATTNGISPAYKKEKYTLKWKRVKEFDLIFV
AVYQSLLHLGWIDKLLENISTIFIDLYKDQVKGNRARIQTYRFDQYFEQQVRELEDNAGGFVEEHVPETGEKKDP
LVSSDNGGPPPPPVPGLVKAQPRAALAGATSDEGTPPATPEISRSSTPQGHLLTAKAGPGGRGSRRSRKAANSNA
NASSGDEARKGKPVKSPVKKMRRWDASGMADEDDGEILDYSAPAEEGETVAPAVEAVSEEDWGRRTGKGQFVLKE
LGEEVQSILDQADAEKSKGTASSGVVGSGFNAIGGFFRNIVGGKVLTESDLEKPLKAMEEHLLKKNVAREAAVRL
CEGVKLEMIGKKTGNFQSTDAALHVAMESSLRKILTPTSSLDLLREINAVVAPTTKQQAPRPYVMSIVGVNGVGK
STNLSKICYFLLQNKYRVLIAACDTFRSGAVEQLRVHADRLKELSVRENAGDVEIYQKGYGKDAANVAKDAVEYA
AANKFDVVLIDTAGRRHNDQRLMSSLEKFAKFANPDKIFMVGEALVGTDSVMQARNFNQAFGTGRNLDGFIISKC
DTVGDMVGTLVSMVHATGIPIVFLGVGQHYGDLRGLSVPWAVSLLMK*
Coding >Pro_DTO377G3_2|g6952.t1
ATGTTGGAGGCTTTTGAAATTTTAACCACATCGGGCGTGGTGCTTTGGTCTAAGGCCTACGCTCCGGTGGGCGCA
CATGTTATCAACAGCCTGATCAACGATGTCTTTATCGAGGAGAAGGTCGTGCCGCAGAATGCTACAACTAATGGG
ATCTCGCCGGCATACAAGAAGGAGAAATATACACTGAAATGGAAGAGAGTCAAGGAATTCGATTTGATCTTCGTG
GCCGTCTACCAATCGCTACTCCACCTTGGCTGGATAGACAAACTTCTTGAGAACATTTCAACCATCTTTATTGAT
CTCTACAAGGACCAGGTGAAGGGAAACCGCGCGAGAATCCAGACCTATCGGTTCGATCAATACTTTGAACAGCAA
GTTCGGGAGCTTGAAGACAACGCTGGTGGATTCGTAGAAGAACATGTGCCAGAGACGGGTGAAAAGAAAGACCCG
CTTGTTTCGTCGGACAATGGAGGCCCACCGCCGCCACCGGTGCCTGGCCTGGTGAAAGCGCAGCCCAGAGCTGCG
CTAGCCGGGGCGACCTCTGATGAGGGTACGCCACCAGCTACACCAGAAATTTCTAGATCTTCGACCCCTCAGGGT
CATCTTCTTACAGCCAAAGCCGGGCCTGGAGGTCGTGGCTCTCGACGTTCCCGCAAGGCTGCCAATTCGAACGCC
AACGCATCGTCTGGTGATGAAGCCCGGAAGGGAAAGCCTGTCAAGTCCCCTGTGAAGAAGATGCGCAGATGGGAT
GCTAGTGGGATGGCAGATGAGGATGACGGAGAAATCCTCGATTATTCTGCCCCCGCGGAGGAAGGAGAGACCGTC
GCCCCTGCGGTGGAGGCTGTCTCCGAGGAGGATTGGGGTCGTCGAACCGGCAAGGGCCAATTCGTGCTGAAAGAG
TTGGGCGAGGAAGTTCAATCCATCTTGGACCAAGCTGATGCTGAAAAGTCCAAAGGTACTGCTTCGTCTGGTGTG
GTTGGCTCCGGGTTCAACGCAATTGGTGGCTTCTTCCGTAACATCGTCGGAGGAAAGGTTCTGACAGAATCTGAT
CTCGAGAAGCCTCTCAAGGCGATGGAAGAACACCTTTTGAAGAAGAATGTCGCCCGTGAAGCTGCTGTCCGGCTC
TGCGAGGGAGTTAAGCTTGAGATGATTGGCAAGAAGACTGGCAATTTCCAGAGTACTGATGCCGCATTGCATGTG
GCCATGGAATCCTCGCTGCGGAAGATCCTGACACCGACCTCTTCTTTGGATTTGCTGCGCGAGATTAACGCTGTG
GTCGCTCCCACCACCAAGCAGCAGGCGCCTCGTCCATATGTCATGTCTATTGTTGGCGTCAACGGCGTTGGAAAG
TCGACCAACCTGAGCAAGATCTGCTACTTCTTGCTTCAAAACAAGTACCGTGTTCTTATTGCCGCTTGCGATACT
TTCCGTTCCGGTGCCGTGGAGCAGCTCCGCGTGCACGCTGACCGCTTGAAGGAACTGAGCGTTCGTGAAAATGCA
GGCGATGTGGAGATCTACCAGAAGGGCTACGGCAAGGACGCAGCCAACGTTGCCAAGGATGCAGTCGAATACGCT
GCGGCCAATAAGTTTGATGTCGTCCTGATCGACACTGCCGGTCGTCGGCATAACGACCAGCGGCTGATGTCGTCG
CTTGAGAAGTTCGCCAAGTTCGCTAACCCAGACAAGATTTTCATGGTTGGTGAGGCTCTGGTCGGCACGGACAGT
GTCATGCAGGCTCGCAACTTCAACCAGGCATTTGGCACCGGTAGGAACTTGGACGGTTTCATTATCAGTAAATGT
GACACTGTCGGCGACATGGTGGGAACACTGGTCAGCATGGTCCATGCCACGGGAATTCCCATTGTGTTCCTGGGC
GTTGGACAACATTATGGAGATCTGCGAGGGCTCAGTGTTCCCTGGGCTGTTAGTCTGCTGATGAAGTAG
Transcript >Pro_DTO377G3_2|g6952.t1
ATGTTGGAGGCTTTTGAAATTTTAACCACATCGGGCGTGGTGCTTTGGTCTAAGGCCTACGCTCCGGTGGGCGCA
CATGTTATCAACAGCCTGATCAACGATGTCTTTATCGAGGAGAAGGTCGTGCCGCAGAATGCTACAACTAATGGG
ATCTCGCCGGCATACAAGAAGGAGAAATATACACTGAAATGGAAGAGAGTCAAGGAATTCGATTTGATCTTCGTG
GCCGTCTACCAATCGCTACTCCACCTTGGCTGGATAGACAAACTTCTTGAGAACATTTCAACCATCTTTATTGAT
CTCTACAAGGACCAGGTGAAGGGAAACCGCGCGAGAATCCAGACCTATCGGTTCGATCAATACTTTGAACAGCAA
GTTCGGGAGCTTGAAGACAACGCTGGTGGATTCGTAGAAGAACATGTGCCAGAGACGGGTGAAAAGAAAGACCCG
CTTGTTTCGTCGGACAATGGAGGCCCACCGCCGCCACCGGTGCCTGGCCTGGTGAAAGCGCAGCCCAGAGCTGCG
CTAGCCGGGGCGACCTCTGATGAGGGTACGCCACCAGCTACACCAGAAATTTCTAGATCTTCGACCCCTCAGGGT
CATCTTCTTACAGCCAAAGCCGGGCCTGGAGGTCGTGGCTCTCGACGTTCCCGCAAGGCTGCCAATTCGAACGCC
AACGCATCGTCTGGTGATGAAGCCCGGAAGGGAAAGCCTGTCAAGTCCCCTGTGAAGAAGATGCGCAGATGGGAT
GCTAGTGGGATGGCAGATGAGGATGACGGAGAAATCCTCGATTATTCTGCCCCCGCGGAGGAAGGAGAGACCGTC
GCCCCTGCGGTGGAGGCTGTCTCCGAGGAGGATTGGGGTCGTCGAACCGGCAAGGGCCAATTCGTGCTGAAAGAG
TTGGGCGAGGAAGTTCAATCCATCTTGGACCAAGCTGATGCTGAAAAGTCCAAAGGTACTGCTTCGTCTGGTGTG
GTTGGCTCCGGGTTCAACGCAATTGGTGGCTTCTTCCGTAACATCGTCGGAGGAAAGGTTCTGACAGAATCTGAT
CTCGAGAAGCCTCTCAAGGCGATGGAAGAACACCTTTTGAAGAAGAATGTCGCCCGTGAAGCTGCTGTCCGGCTC
TGCGAGGGAGTTAAGCTTGAGATGATTGGCAAGAAGACTGGCAATTTCCAGAGTACTGATGCCGCATTGCATGTG
GCCATGGAATCCTCGCTGCGGAAGATCCTGACACCGACCTCTTCTTTGGATTTGCTGCGCGAGATTAACGCTGTG
GTCGCTCCCACCACCAAGCAGCAGGCGCCTCGTCCATATGTCATGTCTATTGTTGGCGTCAACGGCGTTGGAAAG
TCGACCAACCTGAGCAAGATCTGCTACTTCTTGCTTCAAAACAAGTACCGTGTTCTTATTGCCGCTTGCGATACT
TTCCGTTCCGGTGCCGTGGAGCAGCTCCGCGTGCACGCTGACCGCTTGAAGGAACTGAGCGTTCGTGAAAATGCA
GGCGATGTGGAGATCTACCAGAAGGGCTACGGCAAGGACGCAGCCAACGTTGCCAAGGATGCAGTCGAATACGCT
GCGGCCAATAAGTTTGATGTCGTCCTGATCGACACTGCCGGTCGTCGGCATAACGACCAGCGGCTGATGTCGTCG
CTTGAGAAGTTCGCCAAGTTCGCTAACCCAGACAAGATTTTCATGGTTGGTGAGGCTCTGGTCGGCACGGACAGT
GTCATGCAGGCTCGCAACTTCAACCAGGCATTTGGCACCGGTAGGAACTTGGACGGTTTCATTATCAGTAAATGT
GACACTGTCGGCGACATGGTGGGAACACTGGTCAGCATGGTCCATGCCACGGGAATTCCCATTGTGTTCCTGGGC
GTTGGACAACATTATGGAGATCTGCGAGGGCTCAGTGTTCCCTGGGCTGTTAGTCTGCTGATGAAGTAG
Gene >Pro_DTO377G3_2|g6952.t1
ATGTTGGAGGCTTTTGAAATTTTAACCACATCGGGCGTGGTGCTTTGGTCTAAGGCCTACGCTCCGGTGGGCGCA
CATGTTATCAACAGCCTGATCAACGATGTCTTTATCGAGGAGAAGGTCGTGCCGCAGAATGCTACAACTAATGGG
ATCTCGCCGGCATACAAGAAGGAGAAATATACACTGAAATGGAAGAGAGTCAAGGAATTCGATTTGATCTTCGTG
GTATGTCTGTCGCATGCGCATGCGCTCGCTGCTTCGACTAACTCTGGGTTTATGCAGGCCGTCTACCAATCGCTA
CTCCACCTTGGCTGGATAGACAAACTTCTTGAGAACATTTCAACCATCTTTATTGATCTCTACAAGGACCAGGTG
AAGGGAAACCGCGCGAGAATCCAGACCTATCGGTTCGATCAATACTTTGAACAGCAAGTTCGGGAGCTTGAAGAC
AACGCTGGTGGATTCGTAGAAGAACATGTGCCAGAGACGGGTGAAAAGAAAGACCCGCTTGTTTCGTCGGACAAT
GGAGGCCCACCGCCGCCACCGGTGCCTGGCCTGGTGAAAGGTATGGAATGACAAACCCCAGTTTTAGTTTCAAGC
GCATGCTGACCATCCTAAAGCGCAGCCCAGAGCTGCGCTAGCCGGGGCGACCTCTGATGAGGGTACGCCACCAGC
TACACCAGAAATTTCTAGATCTTCGACCCCTCAGGGTCATCTTCTTACAGCCAAAGCCGGGCCTGGAGGTCGTGG
CTCTCGACGTTCCCGCAAGGCTGCCAATTCGAACGCCAACGCATCGTCTGGTGATGAAGCCCGGAAGGGAAAGCC
TGTCAAGTCCCCTGTGAAGAAGATGCGCAGATGGGATGCTAGTGGGATGGCAGATGAGGATGACGGAGAAATCCT
CGATTATTCTGCCCCCGCGGAGGAAGGAGAGACCGTCGCCCCTGCGGTGGAGGCTGTCTCCGAGGAGGATTGGGG
TCGTCGAACCGGCAAGGGCCAATTCGTGCTGAAAGAGTTGGGCGAGGAAGTTCAATCCATCTTGGACCAAGCTGA
TGCTGAAAAGTCCAAAGGTACTGCTTCGTCTGGTGTGGTTGGCTCCGGGTTCAACGCAATTGGTGGCTTCTTCCG
TAACATCGTCGGAGGAAAGGTTCTGACAGAATCTGATCTCGAGAAGCCTCTCAAGGCGATGGAAGAACACCTTTT
GAAGAAGAATGTCGCCCGTGAAGCTGCTGTCCGGCTCTGCGAGGGAGTTAAGCTTGAGATGATTGGCAAGAAGAC
TGGCAATTTCCAGAGTACTGATGCCGCATTGCATGTGGCCATGGAATCCTCGCTGCGGAAGATCCTGACACCGAC
CTCTTCTTTGGATTTGCTGCGCGAGATTAACGCTGTGGTCGCTCCCACCACCAAGCAGCAGGCGCCTCGTCCATA
TGTCATGTCTATTGTTGGCGTCAACGGCGTTGGAAAGTCGACCAACCTGAGCAAGATCTGCTACTTCTTGCTTCA
AAACAAGTACCGTGTTCTTATTGCCGCTTGCGATACTTTCCGTTCCGGTGCCGTGGAGCAGCTCCGCGTGCACGC
TGACCGCTTGAAGGAACTGAGCGTTCGTGAAAATGCAGGCGATGTGGAGATCTACCAGAAGGGCTACGGCAAGGA
CGCAGCCAACGTTGCCAAGGATGCAGTCGAATACGCTGCGGCCAATAAGTTTGATGTCGTCCTGATCGACACTGC
CGGTCGTCGGCATAACGACCAGCGGCTGATGTCGTCGCTTGAGAAGTTCGCCAAGTTCGCTAACCCAGACAAGAT
TTTCATGGTTGGTGAGGCTCTGGTCGGCACGGACAGTGTCATGCAGGCTCGCAACTTCAACCAGGCATTTGGCAC
CGGTAGGAACTTGGACGGTTTCATTATCAGTAAATGTGACACTGTCGGCGACATGGTGGGAACACTGGTCAGCAT
GGTCCATGCCACGGGAATTCCCATTGTGTTCCTGGGCGTTGGACAACATTATGGAGATCTGCGAGGGCTCAGTGT
TCCCTGGGCTGTTAGTCTGCTGATGAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail