Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6951.t1
Gene name
Locationscaffold_20:52526..53695
Strand-
Gene length (bp)1169
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03878 YIF1 YIF1 7.2E-100 70 335

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0048193 Golgi vesicle transport No
GO:0008150 biological_process No
GO:0016020 membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051649 establishment of localization in cell No
GO:0051641 cellular localization No
GO:0046907 intracellular transport No
GO:0016192 vesicle-mediated transport No
GO:0005575 cellular_component No
GO:0031090 organelle membrane No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 170 192 22
2 202 224 22
3 236 255 19
4 265 282 17
5 318 335 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6951.t1
MYRGSFAPPPAQSPPLHHPVPQHVSTVPMMRSPPPPAPQQPPSAGYGGNPYQPSPAQGGYGTPGFGGFMNEPTAQ
MGFQVGKSAMAAGQEYMENNFNRYVSIPALKHYFNVSNSYVLNKLVLVLFPWRHKPWSRQQARMAPTSGPGGQII
QQQYSSMFLPPRDDLNSPDMYIPVMALVTYILLSVLLAGFRGDFHPELLGSITTTAIAVIAFEILCLKLATYILS
INNDSQLLDLLAYSGYKFVGIIVTMVVSEIFNPGQETRGWIGWTVFAYTFLANAFFLLRSLKYVLLPDSTDSAMH
AGSMQAVARSQRNRRGQFLFVYSYAVQFVFMWVLSREGPSSVASTGSASS*
Coding >Pro_DTO377G3_2|g6951.t1
ATGTATCGGGGCTCTTTCGCTCCGCCACCCGCGCAATCGCCGCCTCTTCATCACCCCGTCCCACAACATGTCTCG
ACCGTCCCTATGATGCGCTCACCTCCACCACCAGCTCCCCAGCAACCCCCGAGTGCTGGATATGGCGGTAACCCG
TACCAACCGTCACCGGCTCAGGGTGGCTATGGTACTCCCGGATTCGGCGGGTTCATGAACGAACCCACGGCTCAG
ATGGGCTTCCAAGTCGGCAAAAGCGCAATGGCGGCTGGACAGGAGTACATGGAAAATAACTTCAATCGCTATGTC
TCTATACCCGCTCTCAAGCACTACTTTAACGTCTCCAACTCCTACGTCCTGAACAAGCTGGTCCTTGTCCTCTTC
CCTTGGCGACACAAGCCCTGGTCCCGACAGCAAGCCCGGATGGCTCCAACTTCTGGACCAGGTGGTCAAATCATA
CAGCAACAATACTCATCCATGTTCTTGCCTCCTCGCGACGACCTGAACTCACCGGACATGTATATTCCCGTCATG
GCCCTGGTCACATATATTCTGCTGTCGGTGTTACTGGCTGGATTCCGAGGCGATTTCCACCCAGAGCTTCTCGGT
TCGATCACCACCACGGCCATTGCAGTGATCGCATTTGAGATTCTCTGCTTGAAGCTGGCGACTTACATTTTGAGC
ATCAACAATGACTCCCAGCTGCTGGATCTGCTGGCGTACTCGGGCTACAAGTTTGTTGGAATCATTGTCACCATG
GTTGTCTCTGAGATCTTCAACCCCGGACAAGAGACTAGGGGCTGGATTGGCTGGACGGTGTTCGCGTACACATTT
TTGGCCAATGCGTTCTTCCTGCTTCGCTCGCTCAAATATGTGCTGCTCCCCGATTCGACCGATTCCGCCATGCAT
GCCGGTTCGATGCAGGCTGTGGCCCGGTCCCAGCGCAACCGACGCGGTCAGTTCTTGTTCGTATACTCCTACGCG
GTTCAGTTCGTTTTCATGTGGGTGCTCAGCCGCGAGGGACCGTCATCTGTGGCATCTACCGGCTCTGCATCGTCA
TAA
Transcript >Pro_DTO377G3_2|g6951.t1
ATGTATCGGGGCTCTTTCGCTCCGCCACCCGCGCAATCGCCGCCTCTTCATCACCCCGTCCCACAACATGTCTCG
ACCGTCCCTATGATGCGCTCACCTCCACCACCAGCTCCCCAGCAACCCCCGAGTGCTGGATATGGCGGTAACCCG
TACCAACCGTCACCGGCTCAGGGTGGCTATGGTACTCCCGGATTCGGCGGGTTCATGAACGAACCCACGGCTCAG
ATGGGCTTCCAAGTCGGCAAAAGCGCAATGGCGGCTGGACAGGAGTACATGGAAAATAACTTCAATCGCTATGTC
TCTATACCCGCTCTCAAGCACTACTTTAACGTCTCCAACTCCTACGTCCTGAACAAGCTGGTCCTTGTCCTCTTC
CCTTGGCGACACAAGCCCTGGTCCCGACAGCAAGCCCGGATGGCTCCAACTTCTGGACCAGGTGGTCAAATCATA
CAGCAACAATACTCATCCATGTTCTTGCCTCCTCGCGACGACCTGAACTCACCGGACATGTATATTCCCGTCATG
GCCCTGGTCACATATATTCTGCTGTCGGTGTTACTGGCTGGATTCCGAGGCGATTTCCACCCAGAGCTTCTCGGT
TCGATCACCACCACGGCCATTGCAGTGATCGCATTTGAGATTCTCTGCTTGAAGCTGGCGACTTACATTTTGAGC
ATCAACAATGACTCCCAGCTGCTGGATCTGCTGGCGTACTCGGGCTACAAGTTTGTTGGAATCATTGTCACCATG
GTTGTCTCTGAGATCTTCAACCCCGGACAAGAGACTAGGGGCTGGATTGGCTGGACGGTGTTCGCGTACACATTT
TTGGCCAATGCGTTCTTCCTGCTTCGCTCGCTCAAATATGTGCTGCTCCCCGATTCGACCGATTCCGCCATGCAT
GCCGGTTCGATGCAGGCTGTGGCCCGGTCCCAGCGCAACCGACGCGGTCAGTTCTTGTTCGTATACTCCTACGCG
GTTCAGTTCGTTTTCATGTGGGTGCTCAGCCGCGAGGGACCGTCATCTGTGGCATCTACCGGCTCTGCATCGTCA
TAA
Gene >Pro_DTO377G3_2|g6951.t1
ATGTATCGGGGCTCTTTCGCTCCGCCACCCGCGCAATCGCCGCCTCTTCATCACCCCGTCCCACAACATGTCTCG
ACCGTCCCTATGATGCGCTCACCTCCACCACCAGCTCCCCAGCAACCCCCGAGTGCTGGATATGGCGGTAACCCG
TACCAACCGTCACCGGCTCAGGGTGGCTATGGTACTCCCGGATTCGGCGGGTTCATGAACGAACCCACGGCTCAG
ATGGGCTTCCAAGTCGGCAAAAGCGCAATGGCGGCTGGACAGGAGTACATGGAAAATAACGTATGCATCATCTAC
AAATTTCTATCGTTTATAGCTAACCTGGAGATAATCTACAGTTCAATCGCTATGTCTCTATACCCGCTCTCAAGC
ACTACTTTAACGTCTCCAACTCCTACGTCCTGAACAAGCTGGTCCTTGTCCTCTTCCCTTGGCGACACAAGCCCT
GGTCCCGACAGCAAGCCCGGATGGCTCCAACTTCTGGACCAGGTGGTCAAATCATACAGCAACAATACTCATCCA
TGTTCTTGCCTCCTCGCGACGACCTGAACTCACCGGACATGTATATTCCCGTCATGGCCCTGGTCACATATATTC
TGCTGTCGGTGTTACTGGCTGGATTCCGAGGCGATTTCCACCCAGAGCTTCTCGGTTCGATCACCACCACGGCCA
TTGCAGTGATCGCATTTGAGATTCTCTGCTTGAAGCTGGCGACTTACATTTTGAGCATCAACAATGACTCCCAGC
TGCTGGATCTGCTGGCGTACTCGGGCTACAAGTTTGTTGGAATCATTGTCACCATGGTTGTCTCTGAGATCTTCA
ACCCCGGACAAGAGACTAGGGGCTGGATTGGCTGGACGGTGTTCGCGTACACATTTTTGGCCAATGCGTTCTTCC
TGGTGAGTGACGACTTTATCGCTTTTCAATTCGTTCCGCATTTGCTAATGTCTAAACTCTAGCTTCGCTCGCTCA
AATATGTGCTGCTCCCCGATTCGACCGATTCCGCCATGCATGCCGGTTCGATGCAGGCTGTGGCCCGGTCCCAGC
GCAACCGACGCGGTCAGTTCTTGTTCGTATACTCCTACGCGGTTCAGTTCGTTTTCATGTGGGTGCTCAGCCGCG
AGGGACCGTCATCTGTGGCATCTACCGGCTCTGCATCGTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail