Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g694.t1
Gene name
Locationscaffold_01:1804654..1806149
Strand+
Gene length (bp)1495
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 6.9E-32 46 441

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 75 97 22
3 126 148 22
4 158 177 19
5 184 206 22
6 234 256 22
7 268 290 22
8 310 329 19
9 349 371 22
10 381 403 22
11 416 438 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g694.t1
MAIHTDEIKETSPYPDDPKAVETQEGEVDDKFEVFKRGEGQVDFRTVSWIRASIIFLKIIFATGVLSIPSLMYEL
GAFPGAVSVIAWTVLNAYCAIVQGNFRNAYPGCHSIVDMAQVVGGPIVRELVGFLFTVSYIIVAASGVIGVSTAF
NALSRHSICTVWFSFIAMIIITMCASVRKFSHIGWLTWVGFGSVYVAVFIIVIGVTTRDRPAAAPQTGDFDLGYR
VIGDPNFTTGITASATIFVSSAATSAFLPVISEMRRPKDYPKAVYLSMSLVTASYLTFSLVIYAWCGKWIASPSL
GSAGETVKRVAYGIALPGLIVSGCLYVHVAAKYLFVRILRNSRHLQANTAVHWCTWLSCTIGMSAISFVLACAIP
IFNYVLALVGSLCFAPLAISLPGWLWLYSHRDYWKGNALRVMLYAFHVFLVLLGLFLAVGGTYGVVVQIKEAYAD
GQIESAFSCADNS*
Coding >Pro_DTO377G3_2|g694.t1
ATGGCAATTCATACAGATGAGATCAAGGAAACCTCTCCCTACCCAGACGACCCCAAAGCCGTCGAGACACAAGAA
GGCGAAGTCGACGACAAATTCGAAGTCTTCAAACGGGGCGAGGGCCAAGTCGATTTTCGAACTGTCAGTTGGATT
CGGGCTTCAATTATCTTTCTGAAGATCATCTTCGCAACCGGCGTCCTCTCCATCCCATCATTGATGTATGAGCTA
GGGGCATTCCCTGGCGCCGTTTCCGTGATAGCTTGGACTGTACTCAATGCCTATTGCGCTATTGTGCAGGGTAAC
TTCCGCAATGCCTACCCGGGCTGCCATTCCATCGTGGACATGGCCCAGGTGGTCGGTGGACCGATCGTGAGGGAG
CTTGTTGGCTTCTTGTTCACGGTTAGTTATATTATTGTCGCGGCATCGGGTGTCATTGGCGTATCGACCGCATTC
AATGCCCTGTCACGGCATTCCATCTGTACCGTTTGGTTCTCGTTCATCGCGATGATTATCATTACCATGTGTGCT
AGTGTGCGCAAATTCTCGCATATTGGCTGGCTCACCTGGGTTGGATTTGGCAGTGTCTATGTTGCCGTTTTTATC
ATTGTTATCGGCGTAACAACACGAGACCGACCAGCAGCAGCGCCCCAAACAGGTGACTTCGACCTCGGCTACCGA
GTCATCGGTGACCCCAACTTCACAACCGGCATCACAGCCTCGGCAACGATCTTCGTCTCCAGTGCAGCCACATCC
GCCTTCCTCCCGGTCATTTCGGAGATGCGCAGGCCAAAGGATTACCCCAAAGCAGTCTACCTAAGCATGAGCCTG
GTGACAGCCTCTTACCTGACTTTCAGCCTGGTAATCTACGCCTGGTGCGGCAAGTGGATCGCCTCCCCATCACTT
GGTAGCGCCGGCGAAACCGTCAAGCGGGTCGCCTACGGCATCGCCCTCCCGGGCCTGATTGTCAGCGGCTGTCTC
TACGTACACGTCGCAGCCAAGTACCTCTTCGTGCGAATCCTGCGCAACTCGCGTCATCTGCAAGCGAACACGGCC
GTGCATTGGTGCACTTGGCTGTCGTGTACGATTGGTATGTCGGCTATTTCGTTTGTTTTGGCGTGCGCTATCCCC
ATCTTCAACTATGTGTTGGCATTGGTGGGCAGTTTGTGCTTCGCGCCTTTGGCGATTAGTCTGCCCGGGTGGTTG
TGGTTGTATAGTCATCGCGATTATTGGAAGGGGAATGCGCTGAGGGTCATGTTGTATGCTTTCCATGTCTTTCTC
GTGCTATTAGGGCTGTTTTTGGCCGTTGGAGGCACTTACGGGGTTGTGGTGCAGATTAAGGAGGCTTACGCTGAT
GGACAGATTGAATCTGCCTTTTCTTGCGCTGATAATAGTTGA
Transcript >Pro_DTO377G3_2|g694.t1
ATGGCAATTCATACAGATGAGATCAAGGAAACCTCTCCCTACCCAGACGACCCCAAAGCCGTCGAGACACAAGAA
GGCGAAGTCGACGACAAATTCGAAGTCTTCAAACGGGGCGAGGGCCAAGTCGATTTTCGAACTGTCAGTTGGATT
CGGGCTTCAATTATCTTTCTGAAGATCATCTTCGCAACCGGCGTCCTCTCCATCCCATCATTGATGTATGAGCTA
GGGGCATTCCCTGGCGCCGTTTCCGTGATAGCTTGGACTGTACTCAATGCCTATTGCGCTATTGTGCAGGGTAAC
TTCCGCAATGCCTACCCGGGCTGCCATTCCATCGTGGACATGGCCCAGGTGGTCGGTGGACCGATCGTGAGGGAG
CTTGTTGGCTTCTTGTTCACGGTTAGTTATATTATTGTCGCGGCATCGGGTGTCATTGGCGTATCGACCGCATTC
AATGCCCTGTCACGGCATTCCATCTGTACCGTTTGGTTCTCGTTCATCGCGATGATTATCATTACCATGTGTGCT
AGTGTGCGCAAATTCTCGCATATTGGCTGGCTCACCTGGGTTGGATTTGGCAGTGTCTATGTTGCCGTTTTTATC
ATTGTTATCGGCGTAACAACACGAGACCGACCAGCAGCAGCGCCCCAAACAGGTGACTTCGACCTCGGCTACCGA
GTCATCGGTGACCCCAACTTCACAACCGGCATCACAGCCTCGGCAACGATCTTCGTCTCCAGTGCAGCCACATCC
GCCTTCCTCCCGGTCATTTCGGAGATGCGCAGGCCAAAGGATTACCCCAAAGCAGTCTACCTAAGCATGAGCCTG
GTGACAGCCTCTTACCTGACTTTCAGCCTGGTAATCTACGCCTGGTGCGGCAAGTGGATCGCCTCCCCATCACTT
GGTAGCGCCGGCGAAACCGTCAAGCGGGTCGCCTACGGCATCGCCCTCCCGGGCCTGATTGTCAGCGGCTGTCTC
TACGTACACGTCGCAGCCAAGTACCTCTTCGTGCGAATCCTGCGCAACTCGCGTCATCTGCAAGCGAACACGGCC
GTGCATTGGTGCACTTGGCTGTCGTGTACGATTGGTATGTCGGCTATTTCGTTTGTTTTGGCGTGCGCTATCCCC
ATCTTCAACTATGTGTTGGCATTGGTGGGCAGTTTGTGCTTCGCGCCTTTGGCGATTAGTCTGCCCGGGTGGTTG
TGGTTGTATAGTCATCGCGATTATTGGAAGGGGAATGCGCTGAGGGTCATGTTGTATGCTTTCCATGTCTTTCTC
GTGCTATTAGGGCTGTTTTTGGCCGTTGGAGGCACTTACGGGGTTGTGGTGCAGATTAAGGAGGCTTACGCTGAT
GGACAGATTGAATCTGCCTTTTCTTGCGCTGATAATAGTTGA
Gene >Pro_DTO377G3_2|g694.t1
ATGGCAATTCATACAGATGAGATCAAGGAAACCTCTCCCTACCCAGACGACCCCAAAGCCGTCGAGACACAAGAA
GGCGAAGTCGACGACAAATTCGAAGTCTTCAAACGGGGCGAGGGCCAAGTCGATTTTCGAACTGTCAGTTGGATT
CGGGCTTCAATTATCTTTCTGAAGAGTCAGTTTAGTCCGGTCTCACTATTGCTTCTGTGAAAACTGACACCGTAA
TAGTCATCTTCGCAACCGGCGTCCTCTCCATCCCATCATTGATGTATGAGCTAGGGGCATTCCCTGGCGCCGTTT
CCGTGATAGCTTGGACTGTACTCAATGCCTATTGCGCTATTGTGCAGGGTAACTTCCGCAATGCCTACCCGGGCT
GCCATTCCATCGTGGACATGGCCCAGGTGGTCGGTGGACCGATCGTGAGGGAGCTTGTTGGCTTCTTGTTCACGG
TTAGTTATATTATTGTCGCGGCATCGGGTGTCATTGGCGTATCGACCGCATTCAATGCCCTGTCACGGCATTCCA
TCTGTACCGTTTGGTTCTCGTTCATCGCGATGATTATCATTACCATGTGTGCTAGTGTGCGCAAATTCTCGCATA
TTGGCTGGCTCACCTGGGTTGGATTTGGCAGTGTCTATGTTGCCGTTTTTATCATTGTGTAAGCTTTGGCCACTT
TTCATCTCTCGGACCAAGTACTAATGGCTCTAGTATCGGCGTAACAACACGAGACCGACCAGCAGCAGCGCCCCA
AACAGGTGACTTCGACCTCGGCTACCGAGTCATCGGTGACCCCAACTTCACAACCGGCATCACAGCCTCGGCAAC
GATCTTCGTCTCCAGTGCAGCCACATCCGCCTTCCTCCCGGTCATTTCGGAGATGCGCAGGCCAAAGGATTACCC
CAAAGCAGTCTACCTAAGCATGAGCCTGGTGACAGCCTCTTACCTGACTTTCAGCCTGGTAATCTACGCCTGGTG
CGGCAAGTGGATCGCCTCCCCATCACTTGGTAGCGCCGGCGAAACCGTCAAGCGGGTCGCCTACGGCATCGCCCT
CCCGGGCCTGATTGTCAGCGGCTGTCTCTACGTACACGTCGCAGCCAAGTACCTCTTCGTGCGAATCCTGCGCAA
CTCGCGTCATCTGCAAGCGAACACGGCCGTGCATTGGTGCACTTGGCTGTCGTGTACGATTGGTATGTCGGCTAT
TTCGTTTGTTTTGGCGTGCGCTATCCCCATCTTCAACTATGTGTTGGCATTGGTGGGCAGTTTGTGCTTCGCGCC
TTTGGCGATTAGTCTGCCCGGGTGGTTGTGGTTGTATAGTCATCGCGATTATTGGAAGGGGAATGCGCTGAGGGT
CATGTTGTATGCTTTCCATGTCTTTCTCGTGCTATTAGGGCTGTTTTTGGCCGTTGGAGGCACTTACGGGGTTGT
GGTGCAGATTAAGGAGGCTTACGCTGATGGACAGATTGAATCTGCCTTTTCTTGCGCTGATAATAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail