Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6936.t1
Gene name
Locationscaffold_20:26163..27125
Strand+
Gene length (bp)962
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12678 zf-rbx1 RING-H2 zinc finger domain 3.4E-08 153 191
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 2.1E-06 152 194
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 7.3E-05 164 190

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0004842 ubiquitin-protein transferase activity Yes
GO:0005680 anaphase-promoting complex Yes
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:1902494 catalytic complex No
GO:0044464 cell part No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0140096 catalytic activity, acting on a protein No
GO:0043169 cation binding No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0016740 transferase activity No
GO:0044446 intracellular organelle part No
GO:0003824 catalytic activity No
GO:1990234 transferase complex No
GO:0044424 intracellular part No
GO:0000151 ubiquitin ligase complex No
GO:0046914 transition metal ion binding No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0044428 nuclear part No
GO:0044422 organelle part No
GO:0000152 nuclear ubiquitin ligase complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6936.t1
MADDSMPREEILGVVIGAVALFSLISMIPVMIMRHHRRRAAIRAMAAARVLPPVYQVQLQNVLGQPVSVDRWLEE
QNVPANAQQYGQDTWAGHSVPPPYRDPRVFVEADPCPICLSALSSSPYLACPDPAVLADDQHNPNPTTRPDPRCS
CGAHSPPDSEVLVLNRCKHAFHLDCLKSWFEYRRYKCPICQASYSPEEEARG*
Coding >Pro_DTO377G3_2|g6936.t1
ATGGCGGACGATTCTATGCCGCGAGAGGAGATACTCGGGGTTGTGATTGGGGCAGTTGCGCTGTTTTCCCTGATC
AGCATGATTCCGGTCATGATCATGAGACATCACCGACGACGCGCCGCCATACGGGCCATGGCCGCAGCCCGAGTT
CTCCCACCGGTATATCAGGTACAGTTGCAGAATGTGTTGGGCCAACCTGTGTCCGTGGACCGATGGTTGGAAGAA
CAGAACGTGCCTGCCAATGCGCAACAATATGGCCAAGATACTTGGGCTGGGCATTCGGTCCCTCCGCCCTATCGG
GATCCGCGAGTTTTCGTGGAGGCGGATCCATGCCCCATCTGTCTGTCAGCACTATCGTCGTCCCCATACCTCGCC
TGTCCCGATCCAGCCGTGCTGGCTGACGACCAGCATAATCCCAACCCGACTACACGACCAGACCCCCGCTGCAGC
TGCGGGGCACATTCCCCGCCCGATAGCGAGGTCCTCGTACTCAATCGCTGCAAGCATGCCTTCCATCTAGACTGT
CTGAAGTCCTGGTTTGAATACCGTCGGTATAAGTGTCCGATCTGCCAAGCTTCGTATTCGCCAGAGGAGGAGGCA
CGAGGATGA
Transcript >Pro_DTO377G3_2|g6936.t1
ATGGCGGACGATTCTATGCCGCGAGAGGAGATACTCGGGGTTGTGATTGGGGCAGTTGCGCTGTTTTCCCTGATC
AGCATGATTCCGGTCATGATCATGAGACATCACCGACGACGCGCCGCCATACGGGCCATGGCCGCAGCCCGAGTT
CTCCCACCGGTATATCAGGTACAGTTGCAGAATGTGTTGGGCCAACCTGTGTCCGTGGACCGATGGTTGGAAGAA
CAGAACGTGCCTGCCAATGCGCAACAATATGGCCAAGATACTTGGGCTGGGCATTCGGTCCCTCCGCCCTATCGG
GATCCGCGAGTTTTCGTGGAGGCGGATCCATGCCCCATCTGTCTGTCAGCACTATCGTCGTCCCCATACCTCGCC
TGTCCCGATCCAGCCGTGCTGGCTGACGACCAGCATAATCCCAACCCGACTACACGACCAGACCCCCGCTGCAGC
TGCGGGGCACATTCCCCGCCCGATAGCGAGGTCCTCGTACTCAATCGCTGCAAGCATGCCTTCCATCTAGACTGT
CTGAAGTCCTGGTTTGAATACCGTCGGTATAAGTGTCCGATCTGCCAAGCTTCGTATTCGCCAGAGGAGGAGGCA
CGAGGATGA
Gene >Pro_DTO377G3_2|g6936.t1
ATGGCGGACGATTCTATGCCGCGAGAGGAGATACTCGGGGTTGTGATTGGGGCAGTTGCGCTGTTTTCCCTGATC
AGCATGATTCCGGTGTAAGTACGGAGGCGCGAGAAGTCTTGGCAACCCCCGCGCTTCATGCATGCGAATTGTTCT
CGAACTTCCGAAGTGCCGATCACTGATTTGTATGATTTTCCGTCTAGCATGATCATGAGACATCACCGACGACGC
GCCGCCATACGGGCCATGGCCGCAGCCCGAGTTCTCCCACCGGTATATCAGGTACAGTTGCAGAATGTGTTGGGC
CAACCTGTGTCCGTGGACCGATGGTTGGAAGAACAGAACGTGCCTGCCAATGCGCAACAATATGGCCAAGATACT
TGGTAAGTGCGCTATTCCAGCATTCCACCGGTCTCCGATTCCGGCTGCCCCTCCTCGAGCCTTTTGGCCCCGCGG
CTGGATGATGTCGTGTGGGGACACTAGGGCTGGGCATTCGGTCCCTCCGCCCTATCGGGATCCGCGAGTTTTCGT
GGAGGCGGATCCATGGTTTCTGGGCAAGGCGTTATTGCGCCCAAGGCCAATTTCCGGTGTTCCTGGATAAACACG
CGTGGTCTTGGCTAGAGATAGCAGACCGTGCAAGCGACTCTGGACACATCGACTGAATCTTCTAGAATCAAGCTA
ACTCACCCAGCCCCATCTGTCTGTCAGCACTATCGTCGTCCCCATACCTCGCCTGTCCCGATCCAGCCGTGCTGG
CTGACGACCAGCATAATCCCAACCCGACTACACGACCAGACCCCCGCTGCAGCTGCGGGGCACATTCCCCGCCCG
ATAGCGAGGTCCTCGTACTCAATCGCTGCAAGCATGCCTTCCATCTAGACTGTCTGAAGTCCTGGTTTGAATACC
GTCGGTATAAGTGTCCGATCTGCCAAGCTTCGTATTCGCCAGAGGAGGAGGCACGAGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail