Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6935.t1
Gene name
Locationscaffold_20:21894..25290
Strand-
Gene length (bp)3396
Transcript length (bp)3243
Coding sequence length (bp)3243
Protein length (aa) 1081

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 1.8E-30 131 256
PF00122 E1-E2_ATPase E1-E2 ATPase 9.0E-07 288 358
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 1.8E-26 825 1028
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 1.0E-18 24 91
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 4.8E-14 613 748
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.1E-14 460 557

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 97 116 19
3 298 315 17
4 325 347 22
5 794 816 22
6 831 853 22
7 876 898 22
8 922 944 22
9 974 996 22
10 1006 1028 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6935.t1
MSHKGSGSESHVDITQQPLSQPAHSLTFEDVISELQTNSDDGLTTAEVKQRLEKYGENMLQGDKGVSLAKIVIRQ
IANAMMLVLIIAMAVSFGIQSWIEGGFIAAVIGLNIVVGVYQDYAAEKTMDSLRSLSSPTGVVSRDGKTATVPAN
EIVPGDMVELKVGDTVPADVRLVEAFNFETDEALLTGESLPVQKDAEATFEVDTGPGDRLNIAYSSSTVTRGRAR
GVVVGTGMRTEIGAIAQALRGTDPKRRPVKRGPEGETKKRWYIQAWTLTTTDAIGRFLGTNVGTPLQRKLSKLAL
LLFAIAVIFAIVVAASNDWRGDSEVIIYAVATGLAMIPACLVVVLTITMAVGTKQMVQRHVIVRKLDSLEALGAV
TNICSDKTGTLTQGRMVAKRAWLPSLGTYSVGASNEPLNPEDGELSLIAEPPVKLGEEKLGDVASPDDLLKDNDT
LKDFLNVTAMANLAHLHQSATEGWQARGEPTDIAIQVFASRFNWGLSRWTKGDKPIWQQQAEYPFDSTVKKMSVI
FTKRDDNNSGKSREMIFTKGAVERVLEACTTIKWKPDSEPVPINDEIRDEILENMEALAKEGLRVLAMAGRENTN
PAKEGDSPLPREDVEKDLSFYGLIGLYDPPRPETAGAIALCYKAGISVHMVTGDHPGTARAIAAQVGIIPANMDM
IAKDVADAMVMTASQFDKLTEDEIDQLPTLPLVIARCAPNTKVRMIDALHRRGRFVAMTGDGVNDSPSLKRADVG
IAMGQNGSDVAKDASELVLSDDNFASIINGIEEGRRIFDNIQKFVLHLLAENVALALTLLIGLAFKDETNQSVFP
ISPVEIIWIIMITSGLPDMGLGMEIAAPEVMDRPPQSKQGIFTWEIIVDTLVYGVWMAALCLSAFSLVMFRWGNG
ELAQGCNTHYNDPNKPYDCDTVFRARATTFTCMTWFALFLAWEMMHLRRSFFHMQPDSKKRYTQWMHDIWRNKFL
FFGIMTGFVLAFPIIYIPVINHSVFKHTSISWEWGIVFVETVLFFLGIESWKWCKRVYFRRQDRKAVANGVSPGD
DRRDLRDFSRYTTMDRSDTQASMKVEQSMV*
Coding >Pro_DTO377G3_2|g6935.t1
ATGTCGCACAAAGGTTCCGGCTCCGAGAGCCATGTTGACATTACACAACAACCTCTCTCCCAACCCGCCCATAGT
CTCACCTTCGAAGATGTCATCAGCGAACTCCAGACCAATTCGGACGATGGTCTAACAACTGCGGAGGTCAAGCAA
CGCCTCGAGAAGTATGGCGAGAATATGCTTCAAGGAGACAAAGGCGTCTCCTTGGCGAAGATTGTCATTCGACAG
ATCGCCAACGCCATGATGCTGGTCCTCATCATCGCAATGGCTGTCAGTTTCGGCATCCAGTCCTGGATCGAAGGA
GGTTTCATCGCCGCCGTCATCGGGCTGAACATCGTCGTCGGTGTCTATCAGGATTACGCCGCTGAGAAGACCATG
GATTCGCTGCGATCGCTCAGTTCGCCCACAGGTGTAGTTTCTCGCGACGGCAAGACGGCAACCGTCCCAGCAAAT
GAGATCGTCCCCGGTGACATGGTCGAATTGAAAGTAGGAGATACTGTCCCTGCTGATGTCAGACTCGTTGAAGCA
TTCAATTTCGAAACTGACGAAGCGCTGCTAACTGGCGAGTCCCTCCCAGTCCAAAAAGATGCAGAGGCCACCTTT
GAGGTCGACACAGGCCCAGGCGACAGACTGAACATAGCCTACAGTTCGTCAACCGTGACCCGAGGACGTGCTCGC
GGTGTCGTCGTGGGAACTGGAATGAGAACCGAGATTGGAGCTATCGCGCAAGCCCTCCGTGGTACCGACCCGAAA
CGTCGCCCTGTTAAGCGTGGACCTGAAGGCGAAACGAAGAAGCGATGGTATATCCAGGCTTGGACATTGACGACC
ACTGATGCCATTGGCCGGTTCTTGGGTACCAATGTTGGTACACCTTTGCAGCGGAAACTGTCCAAGCTGGCGCTT
CTGCTCTTTGCCATTGCTGTTATTTTTGCGATTGTGGTTGCTGCGTCGAATGACTGGCGCGGTGATAGCGAGGTT
ATCATTTATGCGGTCGCGACTGGTCTAGCTATGATTCCGGCGTGTTTGGTGGTCGTGTTGACAATTACTATGGCC
GTCGGAACGAAGCAGATGGTCCAGCGCCATGTTATTGTCCGGAAGCTGGATTCCTTGGAGGCGCTCGGTGCTGTT
ACCAACATCTGCTCGGACAAGACTGGTACTCTGACCCAAGGCCGCATGGTCGCAAAGAGGGCTTGGCTCCCATCC
CTAGGAACTTACTCCGTCGGTGCCTCGAATGAACCTCTCAACCCCGAAGACGGCGAGCTGAGCTTGATTGCAGAG
CCCCCGGTCAAACTAGGCGAGGAAAAATTGGGCGATGTTGCATCGCCAGATGACTTGTTAAAAGATAACGATACG
CTCAAGGACTTCCTCAACGTCACTGCCATGGCCAACCTGGCCCATCTTCACCAAAGTGCCACCGAGGGATGGCAG
GCTCGCGGCGAACCCACCGACATTGCCATCCAGGTTTTCGCCTCTCGATTCAACTGGGGTCTGTCTCGCTGGACC
AAGGGCGATAAGCCGATCTGGCAGCAACAGGCCGAGTACCCATTCGACTCAACCGTGAAGAAAATGTCTGTTATT
TTCACAAAGCGCGACGACAATAACTCAGGGAAGAGTCGCGAAATGATCTTCACCAAGGGTGCTGTCGAGCGAGTG
CTCGAGGCATGCACCACTATCAAATGGAAGCCTGACTCGGAGCCCGTTCCTATCAACGATGAAATACGCGATGAA
ATCTTGGAGAACATGGAGGCTTTGGCTAAAGAGGGTCTTCGCGTGCTGGCTATGGCCGGCCGCGAGAACACCAAT
CCTGCAAAAGAAGGCGACAGCCCTCTTCCCCGCGAGGACGTCGAGAAGGATTTGTCTTTCTACGGTTTGATCGGT
CTCTACGATCCTCCTCGTCCGGAGACAGCTGGTGCTATTGCCCTTTGCTACAAGGCTGGAATCTCCGTGCACATG
GTCACCGGTGACCACCCCGGTACTGCGCGTGCGATTGCAGCCCAAGTCGGGATCATTCCTGCGAACATGGATATG
ATCGCGAAGGACGTTGCCGATGCTATGGTTATGACGGCTTCCCAGTTTGACAAATTGACCGAAGATGAGATTGAT
CAACTTCCCACCCTTCCGTTGGTTATTGCTCGCTGTGCCCCTAATACGAAAGTCCGTATGATTGATGCCCTGCAT
CGTCGTGGGCGCTTTGTGGCTATGACTGGTGATGGAGTTAACGATTCTCCCTCGCTCAAGCGGGCTGATGTCGGC
ATTGCCATGGGTCAGAATGGCTCAGATGTGGCCAAGGATGCTTCCGAGCTAGTGCTGTCCGATGATAACTTTGCT
TCTATCATCAACGGTATTGAGGAAGGTCGTCGCATTTTCGATAACATCCAGAAATTCGTTCTACATCTTCTTGCG
GAGAACGTTGCTTTAGCATTGACCCTTCTTATTGGATTGGCCTTCAAGGATGAAACCAACCAGTCTGTCTTCCCT
ATCTCCCCCGTCGAGATCATCTGGATTATCATGATTACATCTGGTCTCCCTGATATGGGTCTGGGAATGGAGATT
GCCGCCCCGGAAGTGATGGACCGACCACCGCAAAGTAAACAAGGTATCTTCACCTGGGAAATCATCGTCGACACC
CTCGTCTACGGAGTCTGGATGGCCGCCCTCTGTCTGTCCGCATTCTCCCTCGTCATGTTCCGATGGGGCAACGGC
GAGCTCGCTCAGGGCTGCAACACACATTACAACGACCCCAACAAACCCTACGACTGCGACACGGTTTTCCGCGCC
CGCGCCACTACCTTCACCTGCATGACCTGGTTCGCCCTCTTCCTCGCCTGGGAGATGATGCATCTGCGCCGCAGC
TTCTTCCACATGCAGCCCGACTCTAAGAAACGCTACACCCAGTGGATGCATGATATCTGGCGCAACAAGTTCCTC
TTCTTCGGCATCATGACTGGCTTCGTTCTTGCATTCCCTATCATCTACATTCCTGTTATCAATCACAGTGTTTTC
AAGCATACCAGCATTTCTTGGGAGTGGGGTATTGTGTTTGTTGAGACGGTGCTTTTCTTCTTGGGTATTGAGAGC
TGGAAGTGGTGCAAGCGTGTTTACTTCCGTCGTCAGGACCGCAAGGCAGTGGCGAATGGTGTTTCGCCTGGTGAT
GACCGTCGGGATCTGAGAGATTTCAGTCGGTATACCACTATGGACCGCTCGGATACCCAGGCTAGTATGAAGGTG
GAGCAATCTATGGTCTAG
Transcript >Pro_DTO377G3_2|g6935.t1
ATGTCGCACAAAGGTTCCGGCTCCGAGAGCCATGTTGACATTACACAACAACCTCTCTCCCAACCCGCCCATAGT
CTCACCTTCGAAGATGTCATCAGCGAACTCCAGACCAATTCGGACGATGGTCTAACAACTGCGGAGGTCAAGCAA
CGCCTCGAGAAGTATGGCGAGAATATGCTTCAAGGAGACAAAGGCGTCTCCTTGGCGAAGATTGTCATTCGACAG
ATCGCCAACGCCATGATGCTGGTCCTCATCATCGCAATGGCTGTCAGTTTCGGCATCCAGTCCTGGATCGAAGGA
GGTTTCATCGCCGCCGTCATCGGGCTGAACATCGTCGTCGGTGTCTATCAGGATTACGCCGCTGAGAAGACCATG
GATTCGCTGCGATCGCTCAGTTCGCCCACAGGTGTAGTTTCTCGCGACGGCAAGACGGCAACCGTCCCAGCAAAT
GAGATCGTCCCCGGTGACATGGTCGAATTGAAAGTAGGAGATACTGTCCCTGCTGATGTCAGACTCGTTGAAGCA
TTCAATTTCGAAACTGACGAAGCGCTGCTAACTGGCGAGTCCCTCCCAGTCCAAAAAGATGCAGAGGCCACCTTT
GAGGTCGACACAGGCCCAGGCGACAGACTGAACATAGCCTACAGTTCGTCAACCGTGACCCGAGGACGTGCTCGC
GGTGTCGTCGTGGGAACTGGAATGAGAACCGAGATTGGAGCTATCGCGCAAGCCCTCCGTGGTACCGACCCGAAA
CGTCGCCCTGTTAAGCGTGGACCTGAAGGCGAAACGAAGAAGCGATGGTATATCCAGGCTTGGACATTGACGACC
ACTGATGCCATTGGCCGGTTCTTGGGTACCAATGTTGGTACACCTTTGCAGCGGAAACTGTCCAAGCTGGCGCTT
CTGCTCTTTGCCATTGCTGTTATTTTTGCGATTGTGGTTGCTGCGTCGAATGACTGGCGCGGTGATAGCGAGGTT
ATCATTTATGCGGTCGCGACTGGTCTAGCTATGATTCCGGCGTGTTTGGTGGTCGTGTTGACAATTACTATGGCC
GTCGGAACGAAGCAGATGGTCCAGCGCCATGTTATTGTCCGGAAGCTGGATTCCTTGGAGGCGCTCGGTGCTGTT
ACCAACATCTGCTCGGACAAGACTGGTACTCTGACCCAAGGCCGCATGGTCGCAAAGAGGGCTTGGCTCCCATCC
CTAGGAACTTACTCCGTCGGTGCCTCGAATGAACCTCTCAACCCCGAAGACGGCGAGCTGAGCTTGATTGCAGAG
CCCCCGGTCAAACTAGGCGAGGAAAAATTGGGCGATGTTGCATCGCCAGATGACTTGTTAAAAGATAACGATACG
CTCAAGGACTTCCTCAACGTCACTGCCATGGCCAACCTGGCCCATCTTCACCAAAGTGCCACCGAGGGATGGCAG
GCTCGCGGCGAACCCACCGACATTGCCATCCAGGTTTTCGCCTCTCGATTCAACTGGGGTCTGTCTCGCTGGACC
AAGGGCGATAAGCCGATCTGGCAGCAACAGGCCGAGTACCCATTCGACTCAACCGTGAAGAAAATGTCTGTTATT
TTCACAAAGCGCGACGACAATAACTCAGGGAAGAGTCGCGAAATGATCTTCACCAAGGGTGCTGTCGAGCGAGTG
CTCGAGGCATGCACCACTATCAAATGGAAGCCTGACTCGGAGCCCGTTCCTATCAACGATGAAATACGCGATGAA
ATCTTGGAGAACATGGAGGCTTTGGCTAAAGAGGGTCTTCGCGTGCTGGCTATGGCCGGCCGCGAGAACACCAAT
CCTGCAAAAGAAGGCGACAGCCCTCTTCCCCGCGAGGACGTCGAGAAGGATTTGTCTTTCTACGGTTTGATCGGT
CTCTACGATCCTCCTCGTCCGGAGACAGCTGGTGCTATTGCCCTTTGCTACAAGGCTGGAATCTCCGTGCACATG
GTCACCGGTGACCACCCCGGTACTGCGCGTGCGATTGCAGCCCAAGTCGGGATCATTCCTGCGAACATGGATATG
ATCGCGAAGGACGTTGCCGATGCTATGGTTATGACGGCTTCCCAGTTTGACAAATTGACCGAAGATGAGATTGAT
CAACTTCCCACCCTTCCGTTGGTTATTGCTCGCTGTGCCCCTAATACGAAAGTCCGTATGATTGATGCCCTGCAT
CGTCGTGGGCGCTTTGTGGCTATGACTGGTGATGGAGTTAACGATTCTCCCTCGCTCAAGCGGGCTGATGTCGGC
ATTGCCATGGGTCAGAATGGCTCAGATGTGGCCAAGGATGCTTCCGAGCTAGTGCTGTCCGATGATAACTTTGCT
TCTATCATCAACGGTATTGAGGAAGGTCGTCGCATTTTCGATAACATCCAGAAATTCGTTCTACATCTTCTTGCG
GAGAACGTTGCTTTAGCATTGACCCTTCTTATTGGATTGGCCTTCAAGGATGAAACCAACCAGTCTGTCTTCCCT
ATCTCCCCCGTCGAGATCATCTGGATTATCATGATTACATCTGGTCTCCCTGATATGGGTCTGGGAATGGAGATT
GCCGCCCCGGAAGTGATGGACCGACCACCGCAAAGTAAACAAGGTATCTTCACCTGGGAAATCATCGTCGACACC
CTCGTCTACGGAGTCTGGATGGCCGCCCTCTGTCTGTCCGCATTCTCCCTCGTCATGTTCCGATGGGGCAACGGC
GAGCTCGCTCAGGGCTGCAACACACATTACAACGACCCCAACAAACCCTACGACTGCGACACGGTTTTCCGCGCC
CGCGCCACTACCTTCACCTGCATGACCTGGTTCGCCCTCTTCCTCGCCTGGGAGATGATGCATCTGCGCCGCAGC
TTCTTCCACATGCAGCCCGACTCTAAGAAACGCTACACCCAGTGGATGCATGATATCTGGCGCAACAAGTTCCTC
TTCTTCGGCATCATGACTGGCTTCGTTCTTGCATTCCCTATCATCTACATTCCTGTTATCAATCACAGTGTTTTC
AAGCATACCAGCATTTCTTGGGAGTGGGGTATTGTGTTTGTTGAGACGGTGCTTTTCTTCTTGGGTATTGAGAGC
TGGAAGTGGTGCAAGCGTGTTTACTTCCGTCGTCAGGACCGCAAGGCAGTGGCGAATGGTGTTTCGCCTGGTGAT
GACCGTCGGGATCTGAGAGATTTCAGTCGGTATACCACTATGGACCGCTCGGATACCCAGGCTAGTATGAAGGTG
GAGCAATCTATGGTCTAG
Gene >Pro_DTO377G3_2|g6935.t1
ATGTCGCACAAAGGTTCCGGCTCCGAGAGCCATGTTGACATTACACAACAACCTCTCTCCCAACCCGCCCATAGT
CTCACCTTCGAAGATGTCATCAGCGAACTCCAGACCAATTCGGACGATGGTCTAACAACTGCGGAGGTCAAGCAA
CGCCTCGAGAAGTATGGCGAGAATATGCTTCAAGGAGACAAAGGCGTCTCCTTGGCGAAGATTGTCATTCGACAG
ATCGCCAACGCCATGATGCTGGTAAGTCAGAAGCCAATATCCATCAAAGAATGATTGCTAAGAAGTTTTAGGTCC
TCATCATCGCAATGGCTGTCAGTTTCGGCATCCAGTCCTGGATCGAAGGAGGTTTCATCGCCGCCGTCATCGGGC
TGAACATCGTCGTCGGTGTCTATCAGGATTACGCCGCTGAGAAGACCATGGATTCGCTGCGATCGCTCAGTTCGC
CCACAGGTGTAGTTTCTCGCGACGGCAAGACGGCAACCGTCCCAGCAAATGAGATCGTCCCCGGTGACATGGTCG
AATTGAAAGTAGGAGATACTGTCCCTGCTGATGTCAGGTATGTACCAACCCGTATAGAATATCAGAATACCAAGC
TAACCCTTCATAGACTCGTTGAAGCATTCAATTTCGAAACTGACGAAGCGCTGCTAACTGGCGAGTCCCTCCCAG
TCCAAAAAGATGCAGAGGCCACCTTTGAGGTCGACACAGGCCCAGGCGACAGACTGAACATAGCCTACAGTTCGT
CAACCGTGACCCGAGGACGTGCTCGCGGTGTCGTCGTGGGAACTGGAATGAGAACCGAGATTGGAGCTATCGCGC
AAGCCCTCCGTGGTACCGACCCGAAACGTCGCCCTGTTAAGCGTGGACCTGAAGGCGAAACGAAGAAGCGATGGT
ATATCCAGGCTTGGACATTGACGACCACTGATGCCATTGGCCGGTTCTTGGGTACCAATGTTGGTACACCTTTGC
AGCGGAAACTGTCCAAGCTGGCGCTTCTGCTCTTTGCCATTGCTGTTATTTTTGCGATTGTGGTTGCTGCGTCGA
ATGACTGGCGCGGTGATAGCGAGGTTATCATTTATGCGGTCGCGACTGGTCTAGCTATGATTCCGGCGTGTTTGG
TGGTCGTGTTGACAATTACTATGGCCGTCGGAACGAAGCAGATGGTCCAGCGCCATGTTATTGTCCGGAAGCTGG
ATTCCTTGGAGGCGCTCGGTGCTGTTACCAACATCTGCTCGGACAAGACTGGTACTCTGACCCAAGGCCGCATGG
TCGCAAAGAGGGCTTGGCTCCCATCCCTAGGAACTTACTCCGTCGGTGCCTCGAATGAACCTCTCAACCCCGAAG
ACGGCGAGCTGAGCTTGATTGCAGAGCCCCCGGTCAAACTAGGCGAGGAAAAATTGGGCGATGTTGCATCGCCAG
ATGACTTGTTAAAAGATAACGATACGCTCAAGGACTTCCTCAACGTCACTGCCATGGCCAACCTGGCCCATCTTC
ACCAAAGTGCCACCGAGGGATGGCAGGCTCGCGGCGAACCCACCGACATTGCCATCCAGGTTTTCGCCTCTCGAT
TCAACTGGGGTCTGTCTCGCTGGACCAAGGGCGATAAGCCGATCTGGCAGCAACAGGCCGAGTACCCATTCGACT
CAACCGTGAAGAAAATGTCTGTTATTTTCACAAAGCGCGACGACAATAACTCAGGGAAGAGTCGCGAAATGATCT
TCACCAAGGGTGCTGTCGAGCGAGTGCTCGAGGCATGCACCACTATCAAATGGAAGCCTGACTCGGAGCCCGTTC
CTATCAACGATGAAATACGCGATGAAATCTTGGAGAACATGGAGGCTTTGGCTAAAGAGGGTCTTCGCGTGCTGG
CTATGGCCGGCCGCGAGAACACCAATCCTGCAAAAGAAGGCGACAGCCCTCTTCCCCGCGAGGACGTCGAGAAGG
ATTTGTCTTTCTACGGTTTGATCGGTCTCTACGATCCTCCTCGTCCGGAGACAGCTGGTGCTATTGCCCTTTGCT
ACAAGGCTGGAATCTCCGTGCACATGGTCACCGGTGACCACCCCGGTACTGCGCGTGCGATTGCAGCCCAAGTCG
GGATCATTCCTGCGAACATGGATATGATCGCGAAGGACGTTGCCGATGCTATGGTTATGACGGCTTCCCAGTTTG
ACAAATTGACCGAAGATGAGATTGATCAACTTCCCACCCTTCCGTTGGTTATTGCTCGCTGTGCCCCTAATACGA
AAGTCCGTATGATTGATGCCCTGCATCGTCGTGGGCGCTTTGTGGCTATGACTGGTGATGGAGTTAACGATTCTC
CCTCGCTCAAGCGGGCTGATGTCGGCATTGCCATGGGTCAGAATGGCTCAGATGTGGCCAAGGATGCTTCCGAGC
TAGTGCTGTCCGATGATAACTTTGCTTCTATCATCAACGGTATTGAGGAAGGTCGTCGCATTTTCGATAACATCC
AGAAATTCGTTCTACATCTTCTTGCGGAGAACGTTGCTTTAGCATTGACCCTTCTTATTGGATTGGCCTTCAAGG
ATGAAACCAACCAGTCTGTCTTCCCTATCTCCCCCGTCGAGATCATCTGGATTATCATGATTACATCTGGTCTCC
CTGATATGGGTCTGGGAATGGAGATTGCCGCCCCGGAAGTGATGGACCGACCACCGCAAAGTGTAAGTTCCTCCA
AGCCTTGCCCTAACAATTCAATTTACTAACAAATCACAGAAACAAGGTATCTTCACCTGGGAAATCATCGTCGAC
ACCCTCGTCTACGGAGTCTGGATGGCCGCCCTCTGTCTGTCCGCATTCTCCCTCGTCATGTTCCGATGGGGCAAC
GGCGAGCTCGCTCAGGGCTGCAACACACATTACAACGACCCCAACAAACCCTACGACTGCGACACGGTTTTCCGC
GCCCGCGCCACTACCTTCACCTGCATGACCTGGTTCGCCCTCTTCCTCGCCTGGGAGATGATGCATCTGCGCCGC
AGCTTCTTCCACATGCAGCCCGACTCTAAGAAACGCTACACCCAGTGGATGCATGATATCTGGCGCAACAAGTTC
CTCTTCTTCGGCATCATGACTGGCTTCGTTCTTGCATTCCCTATCATCTACATTCCTGTTATCAATCACAGTGTT
TTCAAGCATACCAGCATTTCTTGGGAGTGGGGTATTGTGTTTGTTGAGACGGTGCTTTTCTTCTTGGGTATTGAG
AGCTGGAAGTGGTGCAAGCGTGTTTACTTCCGTCGTCAGGACCGCAAGGCAGTGGCGAATGGTGTTTCGCCTGGT
GATGACCGTCGGGATCTGAGAGATTTCAGTCGGTATACCACTATGGACCGCTCGGATACCCAGGCTAGTATGAAG
GTGGAGCAATCTATGGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail