Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6931.t1
Gene name
Locationscaffold_20:3932..5524
Strand-
Gene length (bp)1592
Transcript length (bp)1362
Coding sequence length (bp)1362
Protein length (aa) 454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 6.9E-40 47 431

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.5

Transmembrane Domains

Domain # Start End Length
1 78 100 22
2 127 149 22
3 159 178 19
4 185 207 22
5 227 249 22
6 261 283 22
7 303 322 19
8 342 364 22
9 374 396 22
10 409 431 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6931.t1
MIPDGVTPYQDPTDSESGYNEKKILEERPQYQDAFGDEEGAEVKYKTMKWWQTGMFMIAESVSLGVLSLPKTLAQ
LGLAPALILIVGLGILATYTGYTIYQFRNRYPHIQNLADAGEVLLGAFGRELFGLGQLLFSIFIMASHILTFSVM
MNTVTEHGTCTMVFTAVGFVICFVCSLPRTMKNMTYISCMSFISIVTAVIITMVAVGVQNKGGQNLKATVDTDLV
QAFGAVTNIVFAYCAHVAFFGLLAEMEEPRDFPKALVMLQTFEIVFYVVAAVVIYYYVGQEVTSPALGSAGPIMK
KVAYGIAIPTIIGAGVVNGHIGLKYIYVRMFRGTDRMQKRDLVAIGSWVGIGLACWVIAWVIADAIPVFSDLLSL
ISSLFASWFSYGLGGVYWLFINKGKWFSSPRKIALTVVNLCVILIGGCMCGLGLYVSGKAIHDDSSNDSFSCGNN
AAV*
Coding >Pro_DTO377G3_2|g6931.t1
ATGATTCCAGATGGAGTGACACCCTACCAGGACCCGACTGACTCGGAGTCGGGGTATAATGAGAAGAAGATTCTA
GAGGAGAGGCCACAGTATCAGGATGCCTTTGGAGATGAGGAGGGTGCCGAGGTTAAGTATAAGACTATGAAGTGG
TGGCAAACGGGAATGTTCATGATCGCCGAATCCGTCTCTCTCGGAGTCTTGTCCCTGCCCAAGACCCTCGCCCAG
CTAGGCCTTGCCCCAGCTCTCATCCTGATCGTCGGACTGGGCATTCTCGCTACCTACACCGGATACACAATCTAC
CAATTCCGCAACCGATACCCCCATATCCAGAATTTAGCCGATGCCGGCGAGGTCTTGTTAGGTGCTTTTGGACGC
GAGCTGTTCGGCCTCGGCCAGCTGCTCTTCTCGATTTTCATTATGGCTTCCCACATCTTGACTTTCAGCGTCATG
ATGAATACCGTTACCGAACACGGCACTTGCACGATGGTTTTCACAGCTGTTGGATTCGTCATCTGTTTCGTCTGC
TCTTTACCTCGTACTATGAAGAACATGACCTATATCTCGTGCATGTCCTTTATCAGTATCGTCACTGCTGTCATC
ATCACTATGGTCGCAGTCGGGGTGCAGAACAAGGGTGGTCAGAATCTCAAGGCTACCGTCGACACCGATTTGGTC
CAGGCTTTCGGCGCCGTCACCAACATCGTCTTCGCCTACTGCGCCCACGTGGCTTTCTTCGGTCTGCTCGCTGAG
ATGGAGGAACCGAGGGATTTCCCCAAGGCTCTGGTCATGCTGCAGACCTTTGAAATTGTCTTCTACGTCGTTGCT
GCGGTGGTCATCTACTACTATGTCGGCCAGGAGGTCACATCCCCCGCTCTTGGATCCGCAGGTCCTATCATGAAA
AAGGTGGCTTACGGAATCGCCATCCCAACTATTATCGGTGCCGGCGTCGTCAACGGCCACATCGGTCTGAAGTAC
ATCTACGTGCGCATGTTCCGAGGCACCGACCGCATGCAGAAGCGTGACTTGGTTGCCATTGGTTCCTGGGTAGGC
ATTGGTCTTGCTTGCTGGGTTATTGCCTGGGTTATTGCCGATGCCATTCCCGTCTTCAGTGATTTGCTGAGTTTG
ATTAGCTCGCTGTTCGCGAGTTGGTTCAGTTATGGTCTGGGTGGTGTGTATTGGTTGTTCATTAATAAGGGCAAG
TGGTTCTCTTCGCCGCGGAAGATTGCTCTCACTGTTGTGAACTTGTGCGTTATTCTGATTGGTGGTTGTATGTGT
GGTCTTGGCCTTTATGTTTCCGGCAAGGCTATTCATGATGACTCTTCTAATGACAGCTTCTCTTGCGGTAATAAT
GCTGCGGTCTAG
Transcript >Pro_DTO377G3_2|g6931.t1
ATGATTCCAGATGGAGTGACACCCTACCAGGACCCGACTGACTCGGAGTCGGGGTATAATGAGAAGAAGATTCTA
GAGGAGAGGCCACAGTATCAGGATGCCTTTGGAGATGAGGAGGGTGCCGAGGTTAAGTATAAGACTATGAAGTGG
TGGCAAACGGGAATGTTCATGATCGCCGAATCCGTCTCTCTCGGAGTCTTGTCCCTGCCCAAGACCCTCGCCCAG
CTAGGCCTTGCCCCAGCTCTCATCCTGATCGTCGGACTGGGCATTCTCGCTACCTACACCGGATACACAATCTAC
CAATTCCGCAACCGATACCCCCATATCCAGAATTTAGCCGATGCCGGCGAGGTCTTGTTAGGTGCTTTTGGACGC
GAGCTGTTCGGCCTCGGCCAGCTGCTCTTCTCGATTTTCATTATGGCTTCCCACATCTTGACTTTCAGCGTCATG
ATGAATACCGTTACCGAACACGGCACTTGCACGATGGTTTTCACAGCTGTTGGATTCGTCATCTGTTTCGTCTGC
TCTTTACCTCGTACTATGAAGAACATGACCTATATCTCGTGCATGTCCTTTATCAGTATCGTCACTGCTGTCATC
ATCACTATGGTCGCAGTCGGGGTGCAGAACAAGGGTGGTCAGAATCTCAAGGCTACCGTCGACACCGATTTGGTC
CAGGCTTTCGGCGCCGTCACCAACATCGTCTTCGCCTACTGCGCCCACGTGGCTTTCTTCGGTCTGCTCGCTGAG
ATGGAGGAACCGAGGGATTTCCCCAAGGCTCTGGTCATGCTGCAGACCTTTGAAATTGTCTTCTACGTCGTTGCT
GCGGTGGTCATCTACTACTATGTCGGCCAGGAGGTCACATCCCCCGCTCTTGGATCCGCAGGTCCTATCATGAAA
AAGGTGGCTTACGGAATCGCCATCCCAACTATTATCGGTGCCGGCGTCGTCAACGGCCACATCGGTCTGAAGTAC
ATCTACGTGCGCATGTTCCGAGGCACCGACCGCATGCAGAAGCGTGACTTGGTTGCCATTGGTTCCTGGGTAGGC
ATTGGTCTTGCTTGCTGGGTTATTGCCTGGGTTATTGCCGATGCCATTCCCGTCTTCAGTGATTTGCTGAGTTTG
ATTAGCTCGCTGTTCGCGAGTTGGTTCAGTTATGGTCTGGGTGGTGTGTATTGGTTGTTCATTAATAAGGGCAAG
TGGTTCTCTTCGCCGCGGAAGATTGCTCTCACTGTTGTGAACTTGTGCGTTATTCTGATTGGTGGTTGTATGTGT
GGTCTTGGCCTTTATGTTTCCGGCAAGGCTATTCATGATGACTCTTCTAATGACAGCTTCTCTTGCGGTAATAAT
GCTGCGGTCTAG
Gene >Pro_DTO377G3_2|g6931.t1
ATGATTCCAGATGGAGTGACACCCTACCAGGACCCGACTGACTCGGAGTCGGGGTATAATGAGAAGAAGATTCTA
GAGGAGAGGCCACAGTATCAGGATGCCTTTGGAGATGAGGAGGGTGCCGAGGTTAAGTATAAGACTATGAAGTGG
TGGTAAGTACACGCAATGAAACAATCATCAAGGATATAGGCTAATTCCGTAATAGGCAAACGGGAATGTGTAAGT
GCTACCACACGCATGATCAAAACTGTCATCAGTTGATTAGGTACAATGAACCAACTCTGACCACCATCTAGTCAT
GATCGCCGAATCCGTCTCTCTCGGAGTCTTGTCCCTGCCCAAGACCCTCGCCCAGCTAGGCCTTGCCCCAGCTCT
CATCCTGATCGTCGGACTGGGCATTCTCGCTACCTACACCGGATACACAATCTACCAATTCCGCAACCGATACCC
CCATATCCAGAATTTAGCCGATGCCGGCGAGGTCTTGTTAGGTGCTTTTGGACGCGAGCTGTTCGGCCTCGGCCA
GCTGCTCTTCTCGATTTTCATTATGGCTTCCCACATCTTGACTTTCAGCGTCATGATGAATACCGTTACCGAACA
CGGCACTTGCACGATGGTTTTCACAGCTGTTGGATTCGTCATCTGTTTCGTCTGCTCTTTACCTCGTACTATGAA
GAACATGACCTATATCTCGTGCATGTGTATGTACCAGGTTCCCCTTACTTGGAGAATAATCACTAATTTCCTTCG
ATAGCCTTTATCAGTATCGTCACTGCTGTCATCATCACTATGGTCGCAGTCGGGGTGCAGAACAAGGGTGGTCAG
AATCTCAAGGCTACCGTCGACACCGATTTGGTCCAGGCTTTCGGCGCCGTCACCAACATCGTCTTCGCCTACTGC
GCCCACGTGGCTTTCTTCGGTCTGCTCGCTGAGATGGAGGAACCGAGGGATTTCCCCAAGGCTCTGGTCATGCTG
CAGACCTTTGAAATTGTCTTCTACGTCGTTGCTGCGGTGGTCATCTACTACTATGTCGGCCAGGAGGTCACATCC
CCCGCTCTTGGATCCGCAGGTCCTATCATGAAAAAGGTGGCTTACGGAATCGCCATCCCAACTGTACGTTCTCCC
CATCCGATCCCATATCCAGCAGCTGACATTCTCAGATTATCGGTGCCGGCGTCGTCAACGGCCACATCGGTCTGA
AGTACATCTACGTGCGCATGTTCCGAGGCACCGACCGCATGCAGAAGCGTGACTTGGTTGCCATTGGTTCCTGGG
TAGGCATTGGTCTTGCTTGCTGGGTTATTGCCTGGGTTATTGCCGATGCCATTCCCGTCTTCAGTGATTTGCTGA
GTTTGATTAGCTCGCTGTTCGCGAGTTGGTTCAGTTATGGTCTGGGTGGTGTGTATTGGTTGTTCATTAATAAGG
GCAAGTGGTTCTCTTCGCCGCGGAAGATTGCTCTCACTGTTGTGAACTTGTGCGTTATTCTGATTGGTGGTTGTA
TGTGTGGTCTTGGCCTTTATGTTTCCGGCAAGGCTATTCATGATGACTCTTCTAATGACAGCTTCTCTTGCGGTA
ATAATGCTGCGGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail