Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6920.t1
Gene name
Locationscaffold_19:366599..367377
Strand+
Gene length (bp)778
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 76.75 43.03 110.47
5d_25C Five days - 25 degrees Celsius 106.88 63.04 150.73
7d_25C Seven days - 25 degrees Celsius 102.73 59.99 145.48
10d_25C Ten days - 25 degrees Celsius 123.46 73.73 173.19
7d_15C Seven days - 15 degrees Celsius 100.19 58.29 142.10
7d_30C Seven days - 30 degrees Celsius 112.07 66.04 158.10

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.175982 no
3d_25C 7d_25C 0.250316 no
3d_25C 7d_15C 0.304807 no
3d_25C 7d_30C 0.108699 no
3d_25C 10d_25C 0.033253 yes
5d_25C 7d_25C 0.911898 no
5d_25C 7d_15C 0.848577 no
5d_25C 7d_30C 0.888539 no
5d_25C 10d_25C 0.608528 no
7d_25C 7d_15C 0.945358 no
7d_25C 7d_30C 0.783524 no
7d_25C 10d_25C 0.491949 no
7d_15C 7d_30C 0.713110 no
7d_15C 10d_25C 0.423169 no
7d_30C 10d_25C 0.749008 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6920.t1
MADRGPGTAATVDLLILDYMVCLCISGLLEGISQARASEDIEYFALFVEQLHRRLALHHLESPLPWDLDFKLRIF
YMSNLFLHWYPPKDYDMGPFVPLSDIAVHFLDLCLDAVAHVSRGRWFDLGAHFMVHAMLEEHARFPDQLDALCNW
RTNDSELDIWWEVSRNWFLGHMPPPFGTAGPMSQAEINEGFPLQALQHRYVEFFEDLMDVLDVPLLLQLEQGQLE
GLTREETRQVREYCGI*
Coding >Pro_DTO377G3_2|g6920.t1
ATGGCGGACCGAGGCCCTGGCACAGCAGCGACTGTGGATCTGCTGATTCTCGACTACATGGTCTGCCTATGTATC
AGCGGACTCCTAGAAGGTATTTCACAAGCAAGAGCATCCGAGGACATTGAATACTTTGCGCTTTTTGTTGAACAG
CTCCACCGGCGGCTTGCCCTCCATCACCTCGAAAGCCCCCTGCCCTGGGACCTAGATTTCAAATTGCGCATCTTC
TACATGTCCAATCTATTTCTCCACTGGTACCCCCCCAAAGACTACGACATGGGTCCCTTTGTTCCTCTGTCTGAT
ATCGCAGTCCATTTCTTGGACCTATGCCTCGATGCAGTCGCCCACGTATCCCGGGGACGCTGGTTCGACCTCGGT
GCTCACTTCATGGTCCATGCGATGTTAGAAGAACATGCGCGTTTCCCCGACCAGCTAGACGCACTCTGCAACTGG
AGAACCAACGACAGTGAACTCGATATATGGTGGGAGGTCAGCCGTAACTGGTTCCTTGGGCACATGCCACCCCCA
TTTGGTACGGCGGGTCCAATGAGCCAAGCAGAGATTAATGAGGGGTTTCCCCTCCAAGCACTGCAGCATCGTTAT
GTCGAGTTCTTCGAGGACCTCATGGATGTACTGGATGTGCCCCTTCTTCTTCAGCTGGAGCAAGGTCAGCTGGAA
GGTTTGACTCGGGAGGAGACCCGACAGGTTCGAGAGTATTGTGGAATTTAA
Transcript >Pro_DTO377G3_2|g6920.t1
ATGGCGGACCGAGGCCCTGGCACAGCAGCGACTGTGGATCTGCTGATTCTCGACTACATGGTCTGCCTATGTATC
AGCGGACTCCTAGAAGGTATTTCACAAGCAAGAGCATCCGAGGACATTGAATACTTTGCGCTTTTTGTTGAACAG
CTCCACCGGCGGCTTGCCCTCCATCACCTCGAAAGCCCCCTGCCCTGGGACCTAGATTTCAAATTGCGCATCTTC
TACATGTCCAATCTATTTCTCCACTGGTACCCCCCCAAAGACTACGACATGGGTCCCTTTGTTCCTCTGTCTGAT
ATCGCAGTCCATTTCTTGGACCTATGCCTCGATGCAGTCGCCCACGTATCCCGGGGACGCTGGTTCGACCTCGGT
GCTCACTTCATGGTCCATGCGATGTTAGAAGAACATGCGCGTTTCCCCGACCAGCTAGACGCACTCTGCAACTGG
AGAACCAACGACAGTGAACTCGATATATGGTGGGAGGTCAGCCGTAACTGGTTCCTTGGGCACATGCCACCCCCA
TTTGGTACGGCGGGTCCAATGAGCCAAGCAGAGATTAATGAGGGGTTTCCCCTCCAAGCACTGCAGCATCGTTAT
GTCGAGTTCTTCGAGGACCTCATGGATGTACTGGATGTGCCCCTTCTTCTTCAGCTGGAGCAAGGTCAGCTGGAA
GGTTTGACTCGGGAGGAGACCCGACAGGTTCGAGAGTATTGTGGAATTTAA
Gene >Pro_DTO377G3_2|g6920.t1
ATGGCGGACCGAGGCCCTGGCACAGCAGCGACTGTGGATCTGCTGATTCTCGACTACATGGTCTGCCTATGTATC
AGCGGACTCCTAGAAGGTATTTCACAAGCAAGAGCATCCGAGGACATTGAATACTTTGCGCTTTTTGTTGAACGT
AAGCACCAGAACTGCCAGCAATGGACCATGCATACTGAATATGGCTCTAGAGCTCCACCGGCGGCTTGCCCTCCA
TCACCTCGAAAGCCCCCTGCCCTGGGACCTAGATTTCAAATTGCGCATCTTCTACATGTCCAATCTATTTCTCCA
CTGGTACCCCCCCAAAGACTACGACATGGGTCCCTTTGTTCCTCTGTCTGATATCGCAGTCCATTTCTTGGACCT
ATGCCTCGATGCAGTCGCCCACGTATCCCGGGGACGCTGGTTCGACCTCGGTGCTCACTTCATGGTCCATGCGAT
GTTAGAAGAACATGCGCGTTTCCCCGACCAGCTAGACGCACTCTGCAACTGGAGAACCAACGACAGTGAACTCGA
TATATGGTGGGAGGTCAGCCGTAACTGGTTCCTTGGGCACATGCCACCCCCATTTGGTACGGCGGGTCCAATGAG
CCAAGCAGAGATTAATGAGGGGTTTCCCCTCCAAGCACTGCAGCATCGTTATGTCGAGTTCTTCGAGGACCTCAT
GGATGTACTGGATGTGCCCCTTCTTCTTCAGCTGGAGCAAGGTCAGCTGGAAGGTTTGACTCGGGAGGAGACCCG
ACAGGTTCGAGAGTATTGTGGAATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail