Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6912.t1
Gene nametppA
Locationscaffold_19:347832..350756
Strand-
Gene length (bp)2924
Transcript length (bp)2817
Coding sequence length (bp)2817
Protein length (aa) 939

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00982 Glyco_transf_20 Glycosyltransferase family 20 1.6E-149 241 651
PF02358 Trehalose_PPase Trehalose-phosphatase 1.0E-86 685 920

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0005992 trehalose biosynthetic process Yes
GO:0009058 biosynthetic process No
GO:0046351 disaccharide biosynthetic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0009311 oligosaccharide metabolic process No
GO:0008152 metabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0005991 trehalose metabolic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0005975 carbohydrate metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0005984 disaccharide metabolic process No
GO:0044237 cellular metabolic process No
GO:0009312 oligosaccharide biosynthetic process No
GO:0009987 cellular process No
GO:1901576 organic substance biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 116.93 69.74 164.12
5d_25C Five days - 25 degrees Celsius 112.59 67.08 158.11
7d_25C Seven days - 25 degrees Celsius 118.51 70.85 166.18
10d_25C Ten days - 25 degrees Celsius 115.63 69.05 162.21
7d_15C Seven days - 15 degrees Celsius 131.80 78.30 185.31
7d_30C Seven days - 30 degrees Celsius 85.71 51.62 119.81

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.910630 no
3d_25C 7d_25C 0.970049 no
3d_25C 7d_15C 0.677236 no
3d_25C 7d_30C 0.177394 no
3d_25C 10d_25C 0.975427 no
5d_25C 7d_25C 0.877126 no
5d_25C 7d_15C 0.561253 no
5d_25C 7d_30C 0.251689 no
5d_25C 10d_25C 0.939418 no
7d_25C 7d_15C 0.714961 no
7d_25C 7d_30C 0.154330 no
7d_25C 10d_25C 0.943742 no
7d_15C 7d_30C 0.050897 no
7d_15C 10d_25C 0.642914 no
7d_30C 10d_25C 0.200076 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6912.t1
MSESESPAQVPDDQPNPVLVGPGLKALKNDAYTQATNATPSLEKTSSEAPSYFNNLPRANAVTADPSETKSEPVQ
TAERASSGIDLLRRLSLTAESPETDPRLEHPGLRLSGRLISAAFCIPYKLSFRSGSDWTLKSRSGTSALFDSFAH
LASDETSWSHTLVGWTGEVEPDVDMKAPLQQIHPNSVVAPLTPSNLVANQALNKAAAPVPVDGTKKPPAHPLVEG
ISVTQQDRERLDEQLSSGRHGRVLPVWLSDASEEPEETIMLKDQGRWRRYAERELYPLLHYKQHGPTDGRSERRW
WADYLRLNQLFADRIVQEYQEGDVVWVHDYHLFLLPSLLRQRIPNIYVGFFLHSPFPSSEFVRCLAKRKEILEGV
LGANMIGFQTFSYSRHFTSCCTRVLGFESNSAGVDAYGAHVAVDVFPIGIDARSIQKAAFGAPDIEKTVLGIRKL
YAGKKIIVGRDRLDSVRGVAQKLQAFEIFLERYPEWRDKVVLIQVTSPTSVEEEKEDDNKIAGQISNLVSTINGR
FGSLSFSPVQYYPQYLSPREYFALLRVADVGLITTVRDGMNTTSLEYIVCQQTNHSPLILSEFSGTAGTLPSAIH
INPWDLVGVAGAINQALTMPADQRKEQHLQLYKHVVTNTVSMWSRQFLNRLLTNLSSFDQSVATPALDRAKLMKQ
YRKARRRLFMFDYDGTLTPIVKDPQAAIPSDRVLRTLKSLSADPRNAVWIISGRDQAFLDEWMGHIPELGLSAEH
GCFIRKPGSEDWENLAEKSDMGWQKEVVDVFQHYTERTQGSFIERKRVALTWHYRRADPEYGAFQARECRKALED
TVAKRWDVEVMAGKANLEVRPTFVNKGFIATRLVDEYGTAPGKAPDFILCLGDDFTDEDMFRALKKFDLPRDHVY
SVTVGASSKQTDASWHLLEPADVIGSIQMLFSSANQDH*
Coding >Pro_DTO377G3_2|g6912.t1
ATGTCTGAATCAGAGAGCCCCGCGCAGGTGCCCGATGACCAGCCAAACCCCGTCCTCGTTGGGCCCGGATTAAAG
GCTCTCAAAAATGACGCGTACACTCAAGCGACAAATGCGACACCCAGTCTGGAGAAGACGTCGAGCGAGGCCCCT
TCATACTTTAACAATCTCCCCAGGGCCAACGCTGTAACCGCCGACCCGTCTGAGACTAAGTCAGAGCCAGTGCAG
ACTGCAGAGAGAGCATCATCCGGCATAGATTTGCTGCGCCGCTTAAGCTTGACCGCTGAATCTCCCGAGACTGAT
CCACGCCTAGAACACCCAGGACTTCGCTTGAGTGGCCGTCTCATCAGTGCCGCTTTCTGCATACCATACAAGCTC
AGCTTTCGATCGGGATCAGACTGGACGCTCAAATCGCGCTCCGGTACTTCGGCGCTGTTCGATTCATTTGCACAT
CTTGCATCTGATGAGACATCTTGGTCTCACACCTTAGTAGGCTGGACCGGAGAGGTCGAGCCTGATGTGGACATG
AAAGCACCCTTGCAGCAAATACATCCCAATTCTGTAGTCGCACCTCTAACCCCCAGTAACCTTGTTGCCAACCAA
GCATTGAACAAGGCTGCCGCACCGGTTCCCGTGGACGGAACCAAGAAGCCACCCGCTCATCCGCTGGTAGAGGGA
ATTAGTGTCACCCAACAGGACCGAGAACGACTCGATGAACAATTGAGCTCAGGCCGTCATGGCCGGGTATTGCCT
GTGTGGTTGTCGGATGCATCAGAAGAACCAGAAGAGACTATTATGCTGAAAGACCAAGGGAGATGGCGCCGTTAT
GCCGAACGTGAGTTATATCCTCTACTCCACTACAAGCAACATGGCCCGACAGATGGCCGATCCGAGCGACGGTGG
TGGGCCGACTACCTGCGCCTGAACCAATTGTTTGCGGATCGCATTGTGCAGGAATATCAAGAAGGAGACGTGGTC
TGGGTCCATGATTATCATTTATTTCTTCTACCCAGTCTGCTGCGGCAACGTATCCCGAATATCTACGTGGGATTC
TTCTTACATTCGCCTTTTCCAAGCAGCGAATTCGTCCGGTGTCTTGCAAAGCGCAAGGAGATCCTGGAGGGAGTC
CTGGGTGCCAACATGATTGGATTCCAAACATTTTCCTATTCTCGACACTTTACCTCGTGCTGCACACGTGTTTTG
GGCTTTGAGTCCAACTCCGCCGGGGTGGATGCCTACGGCGCCCATGTTGCAGTAGATGTCTTTCCTATTGGCATC
GACGCACGTTCAATTCAAAAAGCCGCCTTTGGGGCTCCGGATATCGAGAAGACTGTGTTGGGCATTCGCAAGCTC
TACGCTGGAAAGAAAATCATCGTCGGCCGCGATCGACTCGACAGTGTTCGCGGCGTCGCGCAGAAGCTACAGGCA
TTCGAGATTTTCCTGGAGCGCTACCCGGAATGGCGTGACAAAGTCGTCCTCATCCAGGTGACCAGTCCAACTAGC
GTGGAAGAGGAGAAGGAAGACGACAACAAGATTGCTGGCCAAATATCCAATTTGGTTTCGACCATCAACGGAAGA
TTTGGCTCTTTGAGTTTCTCGCCCGTGCAGTACTATCCGCAATACTTATCTCCACGCGAGTATTTCGCTCTGTTG
CGTGTAGCCGATGTCGGCTTGATCACTACGGTGCGAGATGGCATGAACACAACGAGTCTGGAATATATTGTCTGT
CAACAAACCAACCACAGCCCTTTGATTCTTTCCGAATTCTCCGGAACGGCGGGCACCCTGCCTAGTGCCATCCAC
ATCAACCCGTGGGATCTAGTCGGGGTGGCTGGAGCGATCAATCAAGCATTGACTATGCCAGCCGACCAGCGAAAG
GAGCAACACCTCCAGTTATACAAGCATGTGGTGACCAACACAGTTTCCATGTGGTCCAGGCAATTCCTCAATCGC
CTACTGACCAACCTTTCGTCCTTTGACCAATCCGTCGCTACACCTGCACTCGATCGCGCAAAACTAATGAAGCAG
TACCGCAAGGCTCGCCGACGACTGTTCATGTTCGACTACGATGGCACATTGACACCAATTGTCAAGGATCCCCAG
GCAGCCATTCCTTCAGATCGGGTACTCCGTACTCTGAAGAGCCTATCGGCTGACCCACGAAATGCCGTGTGGATT
ATCAGTGGACGGGACCAGGCTTTCCTGGACGAGTGGATGGGCCATATCCCAGAACTAGGATTGAGTGCCGAGCAC
GGTTGTTTTATCCGAAAGCCCGGATCTGAGGATTGGGAGAATTTAGCCGAGAAAAGCGACATGGGATGGCAGAAA
GAAGTGGTTGATGTCTTCCAACATTACACAGAGCGAACACAAGGTTCATTCATTGAACGGAAACGGGTAGCATTG
ACCTGGCACTATCGTCGTGCAGACCCAGAGTACGGTGCGTTCCAGGCTCGCGAGTGTCGAAAGGCTTTGGAGGAC
ACTGTCGCCAAACGATGGGATGTGGAAGTCATGGCAGGCAAGGCCAATCTAGAGGTCCGGCCAACCTTTGTGAAC
AAGGGATTTATCGCCACCCGGTTGGTTGACGAATATGGCACGGCCCCGGGGAAGGCACCGGACTTCATCCTATGT
TTGGGTGATGACTTCACCGATGAAGATATGTTCCGAGCCCTCAAGAAGTTTGATCTACCACGCGACCACGTTTAC
TCAGTTACGGTGGGCGCCAGCTCAAAGCAGACCGATGCCAGCTGGCACTTATTGGAACCGGCCGATGTTATTGGG
TCAATTCAAATGCTTTTTAGCAGCGCCAACCAAGATCACTGA
Transcript >Pro_DTO377G3_2|g6912.t1
ATGTCTGAATCAGAGAGCCCCGCGCAGGTGCCCGATGACCAGCCAAACCCCGTCCTCGTTGGGCCCGGATTAAAG
GCTCTCAAAAATGACGCGTACACTCAAGCGACAAATGCGACACCCAGTCTGGAGAAGACGTCGAGCGAGGCCCCT
TCATACTTTAACAATCTCCCCAGGGCCAACGCTGTAACCGCCGACCCGTCTGAGACTAAGTCAGAGCCAGTGCAG
ACTGCAGAGAGAGCATCATCCGGCATAGATTTGCTGCGCCGCTTAAGCTTGACCGCTGAATCTCCCGAGACTGAT
CCACGCCTAGAACACCCAGGACTTCGCTTGAGTGGCCGTCTCATCAGTGCCGCTTTCTGCATACCATACAAGCTC
AGCTTTCGATCGGGATCAGACTGGACGCTCAAATCGCGCTCCGGTACTTCGGCGCTGTTCGATTCATTTGCACAT
CTTGCATCTGATGAGACATCTTGGTCTCACACCTTAGTAGGCTGGACCGGAGAGGTCGAGCCTGATGTGGACATG
AAAGCACCCTTGCAGCAAATACATCCCAATTCTGTAGTCGCACCTCTAACCCCCAGTAACCTTGTTGCCAACCAA
GCATTGAACAAGGCTGCCGCACCGGTTCCCGTGGACGGAACCAAGAAGCCACCCGCTCATCCGCTGGTAGAGGGA
ATTAGTGTCACCCAACAGGACCGAGAACGACTCGATGAACAATTGAGCTCAGGCCGTCATGGCCGGGTATTGCCT
GTGTGGTTGTCGGATGCATCAGAAGAACCAGAAGAGACTATTATGCTGAAAGACCAAGGGAGATGGCGCCGTTAT
GCCGAACGTGAGTTATATCCTCTACTCCACTACAAGCAACATGGCCCGACAGATGGCCGATCCGAGCGACGGTGG
TGGGCCGACTACCTGCGCCTGAACCAATTGTTTGCGGATCGCATTGTGCAGGAATATCAAGAAGGAGACGTGGTC
TGGGTCCATGATTATCATTTATTTCTTCTACCCAGTCTGCTGCGGCAACGTATCCCGAATATCTACGTGGGATTC
TTCTTACATTCGCCTTTTCCAAGCAGCGAATTCGTCCGGTGTCTTGCAAAGCGCAAGGAGATCCTGGAGGGAGTC
CTGGGTGCCAACATGATTGGATTCCAAACATTTTCCTATTCTCGACACTTTACCTCGTGCTGCACACGTGTTTTG
GGCTTTGAGTCCAACTCCGCCGGGGTGGATGCCTACGGCGCCCATGTTGCAGTAGATGTCTTTCCTATTGGCATC
GACGCACGTTCAATTCAAAAAGCCGCCTTTGGGGCTCCGGATATCGAGAAGACTGTGTTGGGCATTCGCAAGCTC
TACGCTGGAAAGAAAATCATCGTCGGCCGCGATCGACTCGACAGTGTTCGCGGCGTCGCGCAGAAGCTACAGGCA
TTCGAGATTTTCCTGGAGCGCTACCCGGAATGGCGTGACAAAGTCGTCCTCATCCAGGTGACCAGTCCAACTAGC
GTGGAAGAGGAGAAGGAAGACGACAACAAGATTGCTGGCCAAATATCCAATTTGGTTTCGACCATCAACGGAAGA
TTTGGCTCTTTGAGTTTCTCGCCCGTGCAGTACTATCCGCAATACTTATCTCCACGCGAGTATTTCGCTCTGTTG
CGTGTAGCCGATGTCGGCTTGATCACTACGGTGCGAGATGGCATGAACACAACGAGTCTGGAATATATTGTCTGT
CAACAAACCAACCACAGCCCTTTGATTCTTTCCGAATTCTCCGGAACGGCGGGCACCCTGCCTAGTGCCATCCAC
ATCAACCCGTGGGATCTAGTCGGGGTGGCTGGAGCGATCAATCAAGCATTGACTATGCCAGCCGACCAGCGAAAG
GAGCAACACCTCCAGTTATACAAGCATGTGGTGACCAACACAGTTTCCATGTGGTCCAGGCAATTCCTCAATCGC
CTACTGACCAACCTTTCGTCCTTTGACCAATCCGTCGCTACACCTGCACTCGATCGCGCAAAACTAATGAAGCAG
TACCGCAAGGCTCGCCGACGACTGTTCATGTTCGACTACGATGGCACATTGACACCAATTGTCAAGGATCCCCAG
GCAGCCATTCCTTCAGATCGGGTACTCCGTACTCTGAAGAGCCTATCGGCTGACCCACGAAATGCCGTGTGGATT
ATCAGTGGACGGGACCAGGCTTTCCTGGACGAGTGGATGGGCCATATCCCAGAACTAGGATTGAGTGCCGAGCAC
GGTTGTTTTATCCGAAAGCCCGGATCTGAGGATTGGGAGAATTTAGCCGAGAAAAGCGACATGGGATGGCAGAAA
GAAGTGGTTGATGTCTTCCAACATTACACAGAGCGAACACAAGGTTCATTCATTGAACGGAAACGGGTAGCATTG
ACCTGGCACTATCGTCGTGCAGACCCAGAGTACGGTGCGTTCCAGGCTCGCGAGTGTCGAAAGGCTTTGGAGGAC
ACTGTCGCCAAACGATGGGATGTGGAAGTCATGGCAGGCAAGGCCAATCTAGAGGTCCGGCCAACCTTTGTGAAC
AAGGGATTTATCGCCACCCGGTTGGTTGACGAATATGGCACGGCCCCGGGGAAGGCACCGGACTTCATCCTATGT
TTGGGTGATGACTTCACCGATGAAGATATGTTCCGAGCCCTCAAGAAGTTTGATCTACCACGCGACCACGTTTAC
TCAGTTACGGTGGGCGCCAGCTCAAAGCAGACCGATGCCAGCTGGCACTTATTGGAACCGGCCGATGTTATTGGG
TCAATTCAAATGCTTTTTAGCAGCGCCAACCAAGATCACTGA
Gene >Pro_DTO377G3_2|g6912.t1
ATGTCTGAATCAGAGAGCCCCGCGCAGGTGCCCGATGACCAGCCAAACCCCGTCCTCGTTGGGCCCGGATTAAAG
GCTCTCAAAAATGACGCGTACACTCAAGCGACAAATGCGACACCCAGTCTGGAGAAGACGTCGAGCGAGGCCCCT
TCATACTTTAACAATCTCCCCAGGGCCAACGCTGTAACCGCCGACCCGTCTGAGACTAAGTCAGAGCCAGTGCAG
ACTGCAGAGAGAGCATCATCCGGCATAGATTTGCTGCGCCGCTTAAGCTTGACCGCTGAATCTCCCGAGACTGAT
CCACGCCTAGAACACCCAGGACTTCGCTTGAGTGGCCGTCTCATCAGTGCCGCTTTCTGCATACCATACAAGCTC
AGCTTTCGATCGGGATCAGACTGGGTACGTGGATGACTCCGTCTATTTGGGAGATCGTATTGGCTGACCGGATCA
CAGACGCTCAAATCGCGCTCCGGTACTTCGGCGCTGTTCGATTCATTTGCACATCTTGCATCTGATGAGACATCT
TGGTCTCACACCTTAGTAGGCTGGACCGGAGAGGTCGAGCCTGATGTGGACATGAAAGCACCCTTGCAGCAAATA
CATCCCAATTCTGTAGTCGCACCTCTAACCCCCAGTAACCTTGTTGCCAACCAAGCATTGAACAAGGCTGCCGCA
CCGGTTCCCGTGGACGGAACCAAGAAGCCACCCGCTCATCCGCTGGTAGAGGGAATTAGTGTCACCCAACAGGAC
CGAGAACGACTCGATGAACAATTGAGCTCAGGCCGTCATGGCCGGGTATTGCCTGTGTGGTTGTCGGATGCATCA
GAAGAACCAGAAGAGACTATTATGCTGAAAGACCAAGGGAGATGGCGCCGTTATGCCGAACGTGAGTTATATCCT
CTACTCCACTACAAGCAACATGGCCCGACAGATGGCCGATCCGAGCGACGGTGGTGGGCCGACTACCTGCGCCTG
AACCAATTGTTTGCGGATCGCATTGTGCAGGAATATCAAGAAGGAGACGTGGTCTGGGTCCATGATTATCATTTA
TTTCTTCTACCCAGTCTGCTGCGGCAACGTATCCCGAATATCTACGTGGGATTCTTCTTACATTCGCCTTTTCCA
AGCAGCGAATTCGTCCGGTGTCTTGCAAAGCGCAAGGAGATCCTGGAGGGAGTCCTGGGTGCCAACATGATTGGA
TTCCAAACATTTTCCTATTCTCGACACTTTACCTCGTGCTGCACACGTGTTTTGGGCTTTGAGTCCAACTCCGCC
GGGGTGGATGCCTACGGCGCCCATGTTGCAGTAGATGTCTTTCCTATTGGCATCGACGCACGTTCAATTCAAAAA
GCCGCCTTTGGGGCTCCGGATATCGAGAAGACTGTGTTGGGCATTCGCAAGCTCTACGCTGGAAAGAAAATCATC
GTCGGCCGCGATCGACTCGACAGTGTTCGCGGCGTCGCGCAGAAGCTACAGGCATTCGAGATTTTCCTGGAGCGC
TACCCGGAATGGCGTGACAAAGTCGTCCTCATCCAGGTGACCAGTCCAACTAGCGTGGAAGAGGAGAAGGAAGAC
GACAACAAGATTGCTGGCCAAATATCCAATTTGGTTTCGACCATCAACGGAAGATTTGGCTCTTTGAGTTTCTCG
CCCGTGCAGTACTATCCGCAATACTTATCTCCACGCGAGTATTTCGCTCTGTTGCGTGTAGCCGATGTCGGCTTG
ATCACTACGGTGCGAGATGGCATGAACACAACGAGTCTGGAATATATTGTCTGTCAACAAACCAACCACAGCCCT
TTGATTCTTTCCGAATTCTCCGGAACGGCGGGCACCCTGCCTAGTGCCATCCACATCAACCCGTGGGATCTAGTC
GGGGTGGCTGGAGCGATCAATCAAGCATTGACTATGCCAGCCGACCAGCGAAAGGAGCAACACCTCCAGTTATAC
AAGCATGTGGTGACCAACACAGTTTCCATGTGGTCCAGGCAATTCCTCAATCGCCTACTGACCAACCTTTCGTCC
TTTGACCAATCCGTCGCTACACCTGCACTCGATCGCGCAAAACTAATGAAGCAGTACCGCAAGGCTCGCCGACGA
CTGTTCATGTTCGACTACGATGGCACATTGACACCAATTGTCAAGGATCCCCAGGCAGCCATTCCTTCAGATCGG
GTACTCCGTACTCTGAAGAGCCTATCGGCTGACCCACGAAATGCCGTGTGGATTATCAGTGGACGGGACCAGGCT
TTCCTGGACGAGTGGATGGGCCATATCCCAGAACTAGGATTGAGTGCCGAGCACGGTTGTTTTATCCGAAAGCCC
GGATCTGAGGATTGGGAGAATTTAGCCGAGAAAAGCGACATGGGATGGCAGAAAGAAGTGGTTGATGTCTTCCAA
CATTACACAGAGCGAACACAAGGTTCATTCATTGAACGGAAACGGGTAGCATTGACCTGGCACTATCGTCGTGCA
GACCCAGAGTACGGTGCGTTCCAGGCTCGCGAGTGTCGAAAGGCTTTGGAGGACACTGTCGCCAAACGATGGGAT
GTGGAAGTCATGGCAGGCAAGGCCAATCTAGAGGTCCGGCCAACCTTTGTGAACAAGGGATTTATCGCCACCCGG
TTGGTTGACGAATATGGCACGGCCCCGGGGAAGGCACCGGACTTCATCCTATGTTTGGGTGATGACTTCACCGAT
GAAGGTAAAATTGCCCACCTGATTGATGCTGAGATCCTGGATTAACATTCAATTTAGATATGTTCCGAGCCCTCA
AGAAGTTTGATCTACCACGCGACCACGTTTACTCAGTTACGGTGGGCGCCAGCTCAAAGCAGACCGATGCCAGCT
GGCACTTATTGGAACCGGCCGATGTTATTGGGTCAATTCAAATGCTTTTTAGCAGCGCCAACCAAGATCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail