Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6871.t1
Gene name
Locationscaffold_19:240355..244748
Strand+
Gene length (bp)4393
Transcript length (bp)4236
Coding sequence length (bp)4236
Protein length (aa) 1412

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14633 SH2_2 SH2 domain 4.9E-86 1191 1400
PF14641 HTH_44 Helix-turn-helix DNA-binding domain of SPT6 1.2E-35 283 406
PF14635 HHH_7 Helix-hairpin-helix motif 6.6E-31 867 974
PF14639 YqgF Holliday-junction resolvase-like of SPT6 3.7E-27 703 865
PF14632 SPT6_acidic Acidic N-terminal SPT6 2.4E-16 40 122
PF17674 HHH_9 HHH domain 1.5E-06 983 1074
PF00017 SH2 SH2 domain 8.5E-05 1226 1303

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-turn-helix

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6871.t1
MSLRDLIEGEAVMDDDDEEVADDYDAEGRQGAGAANHYNDSSEEEDEEEDDEEAARAVREGFIVDEDEEDERAAR
KHRKRPRAAREEEHLDEEDLELIGHGPSQHRGPATDSKFKRLKRGKDRESYQQSHGVDDIFNSDEEEEAQQYARP
GQRRGLRDEMDDFIEEDTFSDDEAQRERDDLGVAPASRVNKTGLIPTDTSGLDENALEDMRAAFGDGTEYDFALQ
MEDQEDADKQTEERHLDLKDVFEPSELAERMLTEDDNEIRLLDEPERHQVARKPYKHVTLTEDQFREEAVWISNL
MLLKKRMDPELREPFQRSVAKMLEFLITDDWEVPFIFQHRKDYMIHAVKDMANGADPDDESAKYSIRAEKLLNMT
DLWDIFDHDLKFRALIDKRGTIKKTYDNLQSLFNVNDSNVEDQLIAATSMEELQDVQDYIHFQYSSQLRDLNQVN
GDATGETQRRKATGRSFFERVRNGKAYGFVRAFGITADAFAQNASKEGRRQYTEDPTEQPEDLADQFVDNDFSNS
SHVLKAAKSMFAEELAVSPKMRKVIRQAYYMNGVVDCFRTEKGLRRIDEQHPYAEFKYLRNQQLSDIARRPEMFL
RMLKAEEEGLVDVRVRFENFDQFRKRLYADIESDNYSELADAWNRVRREVLDLALGKLEKLINRSVKENIRQECE
NHVAKECREAFSQRLDQAPYKPKGMVLGTVPRVLTLSTGSGQLGRDPIHWAYTEEDGRVLENGKFFDLSVGDESR
DIADGENLAAFLDLMDRRRPDVIGVSGMTPETRRLYKLLSEIVEQKDIRGASYTNEHDEEISDPLEVVIVNDEVA
RLYHNSPRARSDNPGFGPLTHYCVALGRYLQSPLKEYASLGRDVVSIQFKPGQQLVSQDLLLKQLETALVDMVNL
VGVDLNEAVADTATANLLPYVCGLGPRKAAHLLKIVNMNGGVVNNRVELLGVNATYPAMGVKVWNNCASFVYIDF
ENADPDADPLDNTRVHPEDYDIARKMAADALELDEEDIKAETDENGTGAIMRKLFREEAQDRVNDLILEEYAEQL
EKNLNQRKRATLETIRAELQQPYEELRKHYVFLSTDDIFTMLTGETPDSLTPGMVVPIAIKRVFEDHIEAKLDCG
VDVLVAETELGVPYEIPVRNVYQVHQTVPAKILFLNRKGFSCNVSLREDQVSHPSRRNQDHGFGDWDEQQEKADK
ESLQEKTQRGGQAMRVIKHPLFRPFNSTQAEEFLGSQSPGDVVIRPSSRGPDHLAVTWKVAQGVYQHIDVLELDK
ENEFSVGRVLKVGGRYTYSDLDDLIVNHVKAMAKKVGEMVFHEKFQEGSKAETDQWLDTYTKANPRRSAYAFCIN
PKYPGYFYLCFKAGEHARLQNWPVKVIPQGYELQKNPYPDMNALCNGFKLMFSNMSKGNRR*
Coding >Pro_DTO377G3_2|g6871.t1
ATGAGCCTTCGCGACCTAATCGAGGGTGAGGCAGTTATGGATGACGACGATGAGGAAGTTGCCGACGACTATGAT
GCTGAGGGCCGCCAGGGCGCAGGTGCCGCCAATCACTACAATGACTCGAGCGAGGAGGAAGACGAAGAAGAAGAT
GACGAGGAGGCTGCTCGCGCCGTCCGTGAAGGTTTCATTGTTGATGAAGACGAAGAAGACGAGCGTGCCGCCCGC
AAACACCGGAAACGTCCACGCGCTGCTCGCGAAGAAGAGCACCTTGATGAAGAAGATCTGGAACTCATTGGACAT
GGCCCAAGTCAGCATCGTGGACCAGCTACTGATTCAAAGTTTAAGCGCCTGAAGCGAGGCAAAGATCGCGAAAGC
TACCAACAGTCTCACGGCGTTGACGATATTTTCAACTCGGACGAAGAGGAGGAAGCGCAACAATATGCTAGACCA
GGCCAGCGTCGTGGTCTGCGCGATGAAATGGACGACTTTATTGAAGAAGATACCTTCTCTGACGATGAGGCTCAG
CGTGAACGGGATGACCTTGGGGTTGCGCCTGCCTCCAGAGTCAACAAGACCGGCTTGATTCCGACTGACACCTCG
GGCTTGGATGAAAATGCACTTGAGGATATGCGCGCTGCATTTGGTGATGGCACAGAGTACGATTTCGCACTGCAA
ATGGAAGACCAAGAGGACGCCGACAAACAAACCGAAGAACGCCACCTAGATTTGAAGGACGTCTTTGAACCATCC
GAGCTGGCTGAAAGAATGTTGACGGAGGACGATAACGAAATTCGTCTCCTCGATGAACCCGAACGCCATCAGGTT
GCTCGCAAGCCCTATAAACATGTGACATTGACCGAGGATCAATTCCGGGAGGAGGCAGTCTGGATTTCGAACTTG
ATGCTACTAAAGAAGCGCATGGATCCCGAACTGCGCGAACCATTCCAGCGCTCCGTTGCTAAGATGTTAGAATTC
CTGATCACGGACGATTGGGAGGTACCCTTCATTTTTCAGCATCGCAAAGACTACATGATTCATGCTGTCAAAGAT
ATGGCCAATGGCGCCGATCCCGACGACGAGTCCGCCAAATACAGCATCCGGGCCGAGAAACTCCTCAATATGACA
GATTTATGGGATATCTTCGACCATGATCTCAAATTCCGGGCTTTGATCGACAAGCGTGGTACAATTAAAAAGACA
TACGACAATCTGCAAAGCCTCTTCAATGTGAATGATTCCAACGTCGAGGATCAACTTATTGCGGCCACGAGCATG
GAGGAGCTTCAAGATGTGCAGGACTATATCCATTTCCAGTACTCCTCACAGCTACGTGATCTCAACCAGGTCAAT
GGCGATGCTACTGGAGAAACACAACGCCGAAAAGCCACCGGAAGATCTTTCTTTGAGCGTGTTCGGAACGGCAAG
GCCTATGGCTTCGTGCGTGCTTTTGGTATCACTGCAGATGCGTTTGCTCAGAACGCCTCCAAGGAAGGTCGCCGG
CAATACACCGAAGATCCCACCGAGCAGCCTGAAGATTTGGCAGATCAGTTTGTCGACAATGACTTTTCTAACAGT
TCGCATGTCCTCAAAGCTGCTAAGTCAATGTTCGCCGAAGAGCTTGCTGTCAGCCCTAAAATGCGCAAGGTGATC
CGTCAGGCATACTACATGAATGGAGTCGTGGATTGCTTCCGCACAGAGAAAGGACTTCGCCGGATCGATGAGCAG
CATCCGTATGCTGAATTCAAATACCTGCGGAACCAGCAGCTAAGCGATATTGCCCGTCGCCCGGAGATGTTCTTG
CGCATGCTCAAGGCCGAGGAAGAAGGACTCGTTGATGTCCGGGTGAGGTTTGAGAACTTTGACCAGTTCCGCAAA
CGTCTCTACGCCGATATCGAGTCAGACAACTACAGTGAGCTTGCTGATGCTTGGAACCGTGTTCGCCGTGAGGTG
CTGGATTTGGCTTTGGGCAAACTGGAGAAGTTGATCAATCGCAGTGTGAAGGAAAATATTCGACAGGAATGTGAG
AACCATGTGGCCAAGGAGTGCCGCGAAGCGTTCTCACAACGTCTCGACCAGGCCCCTTACAAACCCAAGGGCATG
GTTCTGGGCACAGTGCCCCGTGTTCTCACTCTCTCCACCGGATCTGGTCAGCTGGGCCGGGACCCCATTCACTGG
GCTTACACAGAAGAAGATGGCCGTGTCTTGGAGAATGGCAAATTCTTTGATCTTTCGGTAGGAGATGAGAGCCGT
GACATTGCAGATGGTGAGAACCTAGCCGCATTTTTGGATCTGATGGATCGTCGTCGACCAGATGTCATTGGTGTT
TCAGGCATGACGCCAGAGACGCGCCGCCTGTACAAGCTTCTATCCGAAATAGTCGAACAAAAAGACATACGTGGT
GCATCCTACACAAATGAGCACGATGAGGAGATCAGCGACCCATTAGAGGTGGTCATTGTCAATGATGAGGTTGCC
CGGTTGTACCACAACAGCCCTCGCGCCAGAAGCGACAATCCAGGCTTTGGACCTCTAACCCATTACTGTGTGGCT
CTAGGCCGGTACTTGCAGAGCCCGCTCAAGGAATATGCATCCTTAGGCCGTGACGTTGTCTCCATCCAGTTCAAA
CCAGGCCAGCAACTAGTCTCCCAGGACCTGCTTCTCAAGCAGCTGGAAACCGCACTGGTGGACATGGTCAACTTA
GTCGGCGTTGACCTCAACGAGGCAGTGGCGGACACGGCGACAGCCAATCTCTTGCCGTATGTCTGCGGTCTTGGT
CCCCGAAAGGCGGCTCACTTGCTCAAGATTGTCAATATGAACGGCGGAGTCGTTAACAACCGGGTAGAATTGCTT
GGTGTCAACGCAACATACCCGGCTATGGGTGTCAAGGTTTGGAACAACTGTGCTAGTTTCGTCTATATTGACTTC
GAGAATGCTGATCCCGATGCTGATCCGCTGGATAACACCCGTGTGCATCCCGAAGACTACGATATTGCGCGCAAG
ATGGCCGCCGACGCACTTGAGCTGGACGAGGAAGATATCAAGGCCGAAACTGACGAGAACGGCACTGGTGCCATC
ATGCGGAAGCTGTTCCGGGAAGAGGCACAGGACCGTGTCAACGATCTTATTTTGGAGGAGTACGCAGAGCAGCTT
GAGAAAAACCTCAACCAGCGCAAGCGTGCCACACTCGAGACGATCCGAGCCGAGTTACAACAACCCTACGAGGAA
TTGCGCAAGCACTATGTCTTCCTCAGCACCGATGATATTTTCACAATGCTCACTGGCGAGACGCCCGACTCTTTA
ACACCTGGTATGGTGGTGCCCATTGCTATCAAGCGGGTATTTGAGGATCACATTGAGGCCAAATTGGATTGCGGA
GTTGATGTACTCGTGGCCGAGACCGAACTCGGCGTTCCCTACGAAATCCCTGTACGCAATGTATACCAAGTCCAC
CAAACTGTCCCGGCCAAGATTCTGTTCTTGAACCGCAAGGGTTTCTCTTGCAACGTCTCTCTACGTGAGGATCAG
GTCAGCCATCCATCTCGTCGGAACCAGGATCATGGCTTCGGCGATTGGGACGAACAGCAAGAGAAAGCCGACAAG
GAGTCGCTGCAAGAAAAGACGCAGCGTGGCGGCCAAGCCATGCGTGTCATCAAGCACCCGCTTTTCCGGCCGTTC
AACTCTACCCAGGCCGAGGAGTTCCTAGGTTCTCAAAGCCCAGGCGACGTTGTTATTCGCCCGTCCTCCCGAGGT
CCCGATCACTTAGCTGTCACCTGGAAGGTGGCGCAAGGTGTGTACCAGCACATCGATGTTCTCGAGCTGGACAAA
GAGAACGAGTTCTCTGTCGGCCGTGTCCTCAAGGTCGGTGGTCGGTATACTTATAGTGACCTGGACGACCTGATC
GTCAATCACGTCAAAGCGATGGCCAAGAAGGTGGGCGAGATGGTATTCCACGAGAAATTCCAAGAAGGCAGCAAG
GCCGAGACAGATCAATGGCTCGATACTTATACCAAGGCCAACCCTCGCCGCTCGGCATATGCATTCTGCATCAAC
CCCAAATACCCCGGTTACTTTTATCTTTGCTTCAAGGCAGGCGAGCATGCACGACTTCAAAACTGGCCGGTCAAG
GTGATTCCCCAGGGCTACGAACTGCAGAAGAACCCCTACCCGGACATGAACGCTCTATGCAACGGCTTTAAGCTG
ATGTTTAGCAACATGAGCAAGGGCAACCGGAGATGA
Transcript >Pro_DTO377G3_2|g6871.t1
ATGAGCCTTCGCGACCTAATCGAGGGTGAGGCAGTTATGGATGACGACGATGAGGAAGTTGCCGACGACTATGAT
GCTGAGGGCCGCCAGGGCGCAGGTGCCGCCAATCACTACAATGACTCGAGCGAGGAGGAAGACGAAGAAGAAGAT
GACGAGGAGGCTGCTCGCGCCGTCCGTGAAGGTTTCATTGTTGATGAAGACGAAGAAGACGAGCGTGCCGCCCGC
AAACACCGGAAACGTCCACGCGCTGCTCGCGAAGAAGAGCACCTTGATGAAGAAGATCTGGAACTCATTGGACAT
GGCCCAAGTCAGCATCGTGGACCAGCTACTGATTCAAAGTTTAAGCGCCTGAAGCGAGGCAAAGATCGCGAAAGC
TACCAACAGTCTCACGGCGTTGACGATATTTTCAACTCGGACGAAGAGGAGGAAGCGCAACAATATGCTAGACCA
GGCCAGCGTCGTGGTCTGCGCGATGAAATGGACGACTTTATTGAAGAAGATACCTTCTCTGACGATGAGGCTCAG
CGTGAACGGGATGACCTTGGGGTTGCGCCTGCCTCCAGAGTCAACAAGACCGGCTTGATTCCGACTGACACCTCG
GGCTTGGATGAAAATGCACTTGAGGATATGCGCGCTGCATTTGGTGATGGCACAGAGTACGATTTCGCACTGCAA
ATGGAAGACCAAGAGGACGCCGACAAACAAACCGAAGAACGCCACCTAGATTTGAAGGACGTCTTTGAACCATCC
GAGCTGGCTGAAAGAATGTTGACGGAGGACGATAACGAAATTCGTCTCCTCGATGAACCCGAACGCCATCAGGTT
GCTCGCAAGCCCTATAAACATGTGACATTGACCGAGGATCAATTCCGGGAGGAGGCAGTCTGGATTTCGAACTTG
ATGCTACTAAAGAAGCGCATGGATCCCGAACTGCGCGAACCATTCCAGCGCTCCGTTGCTAAGATGTTAGAATTC
CTGATCACGGACGATTGGGAGGTACCCTTCATTTTTCAGCATCGCAAAGACTACATGATTCATGCTGTCAAAGAT
ATGGCCAATGGCGCCGATCCCGACGACGAGTCCGCCAAATACAGCATCCGGGCCGAGAAACTCCTCAATATGACA
GATTTATGGGATATCTTCGACCATGATCTCAAATTCCGGGCTTTGATCGACAAGCGTGGTACAATTAAAAAGACA
TACGACAATCTGCAAAGCCTCTTCAATGTGAATGATTCCAACGTCGAGGATCAACTTATTGCGGCCACGAGCATG
GAGGAGCTTCAAGATGTGCAGGACTATATCCATTTCCAGTACTCCTCACAGCTACGTGATCTCAACCAGGTCAAT
GGCGATGCTACTGGAGAAACACAACGCCGAAAAGCCACCGGAAGATCTTTCTTTGAGCGTGTTCGGAACGGCAAG
GCCTATGGCTTCGTGCGTGCTTTTGGTATCACTGCAGATGCGTTTGCTCAGAACGCCTCCAAGGAAGGTCGCCGG
CAATACACCGAAGATCCCACCGAGCAGCCTGAAGATTTGGCAGATCAGTTTGTCGACAATGACTTTTCTAACAGT
TCGCATGTCCTCAAAGCTGCTAAGTCAATGTTCGCCGAAGAGCTTGCTGTCAGCCCTAAAATGCGCAAGGTGATC
CGTCAGGCATACTACATGAATGGAGTCGTGGATTGCTTCCGCACAGAGAAAGGACTTCGCCGGATCGATGAGCAG
CATCCGTATGCTGAATTCAAATACCTGCGGAACCAGCAGCTAAGCGATATTGCCCGTCGCCCGGAGATGTTCTTG
CGCATGCTCAAGGCCGAGGAAGAAGGACTCGTTGATGTCCGGGTGAGGTTTGAGAACTTTGACCAGTTCCGCAAA
CGTCTCTACGCCGATATCGAGTCAGACAACTACAGTGAGCTTGCTGATGCTTGGAACCGTGTTCGCCGTGAGGTG
CTGGATTTGGCTTTGGGCAAACTGGAGAAGTTGATCAATCGCAGTGTGAAGGAAAATATTCGACAGGAATGTGAG
AACCATGTGGCCAAGGAGTGCCGCGAAGCGTTCTCACAACGTCTCGACCAGGCCCCTTACAAACCCAAGGGCATG
GTTCTGGGCACAGTGCCCCGTGTTCTCACTCTCTCCACCGGATCTGGTCAGCTGGGCCGGGACCCCATTCACTGG
GCTTACACAGAAGAAGATGGCCGTGTCTTGGAGAATGGCAAATTCTTTGATCTTTCGGTAGGAGATGAGAGCCGT
GACATTGCAGATGGTGAGAACCTAGCCGCATTTTTGGATCTGATGGATCGTCGTCGACCAGATGTCATTGGTGTT
TCAGGCATGACGCCAGAGACGCGCCGCCTGTACAAGCTTCTATCCGAAATAGTCGAACAAAAAGACATACGTGGT
GCATCCTACACAAATGAGCACGATGAGGAGATCAGCGACCCATTAGAGGTGGTCATTGTCAATGATGAGGTTGCC
CGGTTGTACCACAACAGCCCTCGCGCCAGAAGCGACAATCCAGGCTTTGGACCTCTAACCCATTACTGTGTGGCT
CTAGGCCGGTACTTGCAGAGCCCGCTCAAGGAATATGCATCCTTAGGCCGTGACGTTGTCTCCATCCAGTTCAAA
CCAGGCCAGCAACTAGTCTCCCAGGACCTGCTTCTCAAGCAGCTGGAAACCGCACTGGTGGACATGGTCAACTTA
GTCGGCGTTGACCTCAACGAGGCAGTGGCGGACACGGCGACAGCCAATCTCTTGCCGTATGTCTGCGGTCTTGGT
CCCCGAAAGGCGGCTCACTTGCTCAAGATTGTCAATATGAACGGCGGAGTCGTTAACAACCGGGTAGAATTGCTT
GGTGTCAACGCAACATACCCGGCTATGGGTGTCAAGGTTTGGAACAACTGTGCTAGTTTCGTCTATATTGACTTC
GAGAATGCTGATCCCGATGCTGATCCGCTGGATAACACCCGTGTGCATCCCGAAGACTACGATATTGCGCGCAAG
ATGGCCGCCGACGCACTTGAGCTGGACGAGGAAGATATCAAGGCCGAAACTGACGAGAACGGCACTGGTGCCATC
ATGCGGAAGCTGTTCCGGGAAGAGGCACAGGACCGTGTCAACGATCTTATTTTGGAGGAGTACGCAGAGCAGCTT
GAGAAAAACCTCAACCAGCGCAAGCGTGCCACACTCGAGACGATCCGAGCCGAGTTACAACAACCCTACGAGGAA
TTGCGCAAGCACTATGTCTTCCTCAGCACCGATGATATTTTCACAATGCTCACTGGCGAGACGCCCGACTCTTTA
ACACCTGGTATGGTGGTGCCCATTGCTATCAAGCGGGTATTTGAGGATCACATTGAGGCCAAATTGGATTGCGGA
GTTGATGTACTCGTGGCCGAGACCGAACTCGGCGTTCCCTACGAAATCCCTGTACGCAATGTATACCAAGTCCAC
CAAACTGTCCCGGCCAAGATTCTGTTCTTGAACCGCAAGGGTTTCTCTTGCAACGTCTCTCTACGTGAGGATCAG
GTCAGCCATCCATCTCGTCGGAACCAGGATCATGGCTTCGGCGATTGGGACGAACAGCAAGAGAAAGCCGACAAG
GAGTCGCTGCAAGAAAAGACGCAGCGTGGCGGCCAAGCCATGCGTGTCATCAAGCACCCGCTTTTCCGGCCGTTC
AACTCTACCCAGGCCGAGGAGTTCCTAGGTTCTCAAAGCCCAGGCGACGTTGTTATTCGCCCGTCCTCCCGAGGT
CCCGATCACTTAGCTGTCACCTGGAAGGTGGCGCAAGGTGTGTACCAGCACATCGATGTTCTCGAGCTGGACAAA
GAGAACGAGTTCTCTGTCGGCCGTGTCCTCAAGGTCGGTGGTCGGTATACTTATAGTGACCTGGACGACCTGATC
GTCAATCACGTCAAAGCGATGGCCAAGAAGGTGGGCGAGATGGTATTCCACGAGAAATTCCAAGAAGGCAGCAAG
GCCGAGACAGATCAATGGCTCGATACTTATACCAAGGCCAACCCTCGCCGCTCGGCATATGCATTCTGCATCAAC
CCCAAATACCCCGGTTACTTTTATCTTTGCTTCAAGGCAGGCGAGCATGCACGACTTCAAAACTGGCCGGTCAAG
GTGATTCCCCAGGGCTACGAACTGCAGAAGAACCCCTACCCGGACATGAACGCTCTATGCAACGGCTTTAAGCTG
ATGTTTAGCAACATGAGCAAGGGCAACCGGAGATGA
Gene >Pro_DTO377G3_2|g6871.t1
ATGAGCCTTCGCGACCTAATCGAGGGTGAGGCAGTTATGGATGACGACGATGAGGAAGTTGCCGACGACTATGAT
GCTGAGGGCCGCCAGGGCGCAGGTGCCGCCAATCACTACAATGACTCGAGCGAGGAGGAAGACGAAGAAGAAGAT
GACGAGGAGGCTGCTCGCGCCGTCAGTTTTCGCCTTTCACCGGGTTGTATCTCTTTGCTGACGAACTATTAGGTC
CGTGAAGGTTTCATTGTTGATGAAGACGAAGAAGACGAGCGTGCCGCCCGCAAACACCGGAAACGTCCACGCGCT
GCTCGCGAAGAAGAGCACCTTGATGAAGAAGATCTGGAACTCATTGGACATGGCCCAAGTCAGCATCGTGGACCA
GCTACTGATGTATGTAAGCCGCAGCTCATTACTTGACAAGATTCTGATGCTCTGATTTTAGTCAAAGTTTAAGCG
CCTGAAGCGAGGCAAAGATCGCGAAAGCTACCAACAGTCTCACGGCGTTGACGATATTTTCAACTCGGACGAAGA
GGAGGAAGCGCAACAATATGCTAGACCAGGCCAGCGTCGTGGTCTGCGCGATGAAATGGACGACTTTATTGAAGA
AGATACCTTCTCTGACGATGAGGCTCAGCGTGAACGGGATGACCTTGGGGTTGCGCCTGCCTCCAGAGTCAACAA
GACCGGCTTGATTCCGACTGACACCTCGGGCTTGGATGAAAATGCACTTGAGGATATGCGCGCTGCATTTGGTGA
TGGCACAGAGTACGATTTCGCACTGCAAATGGAAGACCAAGAGGACGCCGACAAACAAACCGAAGAACGCCACCT
AGATTTGAAGGACGTCTTTGAACCATCCGAGCTGGCTGAAAGAATGTTGACGGAGGACGATAACGAAATTCGTCT
CCTCGATGAACCCGAACGCCATCAGGTTGCTCGCAAGCCCTATAAACATGTGACATTGACCGAGGATCAATTCCG
GGAGGAGGCAGTCTGGATTTCGAACTTGATGCTACTAAAGAAGCGCATGGATCCCGAACTGCGCGAACCATTCCA
GCGCTCCGTTGCTAAGATGTTAGAATTCCTGATCACGGACGATTGGGAGGTACCCTTCATTTTTCAGCATCGCAA
AGACTACATGATTCATGCTGTCAAAGATATGGCCAATGGCGCCGATCCCGACGACGAGTCCGCCAAATACAGCAT
CCGGGCCGAGAAACTCCTCAATATGACAGATTTATGGGATATCTTCGACCATGATCTCAAATTCCGGGCTTTGAT
CGACAAGCGTGGTACAATTAAAAAGACATACGACAATCTGCAAAGCCTCTTCAATGTGAATGATTCCAACGTCGA
GGATCAACTTATTGCGGCCACGAGCATGGAGGAGCTTCAAGATGTGCAGGACTATATCCATTTCCAGTACTCCTC
ACAGCTACGTGATCTCAACCAGGTCAATGGCGATGCTACTGGAGAAACACAACGCCGAAAAGCCACCGGAAGATC
TTTCTTTGAGCGTGTTCGGAACGGCAAGGCCTATGGCTTCGTGCGTGCTTTTGGTATCACTGCAGATGCGTTTGC
TCAGAACGCCTCCAAGGAAGGTCGCCGGCAATACACCGAAGATCCCACCGAGCAGCCTGAAGATTTGGCAGATCA
GTTTGTCGACAATGACTTTTCTAACAGTTCGCATGTCCTCAAAGCTGCTAAGTCAATGTTCGCCGAAGAGCTTGC
TGTCAGCCCTAAAATGCGCAAGGTGATCCGTCAGGCATACTACATGAATGGAGTCGTGGATTGCTTCCGCACAGA
GAAAGGACTTCGCCGGATCGATGAGCAGCATCCGTATGCTGAATTCAAATACCTGCGGAACCAGCAGCTAAGCGA
TATTGCCCGTCGCCCGGAGATGTTCTTGCGCATGCTCAAGGCCGAGGAAGAAGGACTCGTTGATGTCCGGGTGAG
GTTTGAGAACTTTGACCAGTTCCGCAAACGTCTCTACGCCGATATCGAGTCAGACAACTACAGTGAGCTTGCTGA
TGCTTGGAACCGTGTTCGCCGTGAGGTGCTGGATTTGGCTTTGGGCAAACTGGAGAAGTTGATCAATCGCAGTGT
GAAGGAAAATATTCGACAGGAATGTGAGAACCATGTGGCCAAGGAGTGCCGCGAAGCGTTCTCACAACGTCTCGA
CCAGGCCCCTTACAAACCCAAGGGCATGGTTCTGGGCACAGTGCCCCGTGTTCTCACTCTCTCCACCGGATCTGG
TCAGCTGGGCCGGGACCCCATTCACTGGGCTTACACAGAAGAAGATGGCCGTGTCTTGGAGAATGGCAAATTCTT
TGATCTTTCGGTAGGAGATGAGAGCCGTGACATTGCAGATGGTGAGAACCTAGCCGCATTTTTGGATCTGATGGA
TCGTCGTCGACCAGATGTCATTGGTGTTTCAGGCATGACGCCAGAGACGCGCCGCCTGTACAAGCTTCTATCCGA
AATAGTCGAACAAAAAGACATACGTGGTGCATCCTACACAAATGAGCACGATGAGGAGATCAGCGACCCATTAGA
GGTGGTCATTGTCAATGATGAGGTTGCCCGGTTGTACCACAACAGCCCTCGCGCCAGAAGCGACAATCCAGGCTT
TGGACCTCTAACCCATTACTGTGTGGCTCTAGGCCGGTACTTGCAGAGCCCGCTCAAGGAATATGCATCCTTAGG
CCGTGACGTTGTCTCCATCCAGTTCAAACCAGGCCAGCAACTAGTCTCCCAGGACCTGCTTCTCAAGCAGCTGGA
AACCGCACTGGTGGACATGGTCAACTTAGTCGGCGTTGACCTCAACGAGGCAGTGGCGGACACGGCGACAGCCAA
TCTCTTGCCGTATGTCTGCGGTCTTGGTCCCCGAAAGGCGGCTCACTTGCTCAAGATTGTCAATATGAACGGCGG
AGTCGTTAACAACCGGGTAGAATTGCTTGGTGTCAACGCAACATACCCGGCTATGGGTGTCAAGGTTTGGAACAA
CTGTGCTAGTTTCGTCTATATTGACTTCGAGAATGCTGATCCCGATGCTGATCCGCTGGATAACACCCGTGTGCA
TCCCGAAGACTACGATATTGCGCGCAAGATGGCCGCCGACGCACTTGAGCTGGACGAGGAAGATATCAAGGCCGA
AACTGACGAGAACGGCACTGGTGCCATCATGCGGAAGCTGTTCCGGGAAGAGGCACAGGACCGTGTCAACGATCT
TATTTTGGAGGAGTACGCAGAGCAGCTTGAGAAAAACCTCAACCAGCGCAAGCGTGCCACACTCGAGACGATCCG
AGCCGAGTTACAACAACCCTACGAGGAATTGCGCAAGCACTATGTCTTCCTCAGCACCGATGATATTTTCACAAT
GCTCACTGGCGAGACGCCCGACTCTTTAACACCTGGTATGGTGGTGCCCATTGCTATCAAGCGGGTATTTGAGGA
TCACATTGAGGCCAAATTGGATTGCGGAGTTGATGTACTCGTGGCCGAGACCGAACTCGGCGTTCCCTACGAAAT
CCCTGTACGCAATGTATACCAAGTCCACCAAACTGTCCCGGCCAAGATTCTGTTCTTGAACCGCAAGGGTTTCTC
TTGCAACGTCTCTCTACGTGAGGATCAGGTCAGCCATCCATCTCGTCGGAACCAGGATCATGGCTTCGGCGATTG
GGACGAACAGCAAGAGAAAGCCGACAAGGAGTCGCTGCAAGAAAAGACGCAGCGTGGCGGCCAAGCCATGCGTGT
CATCAAGCACCCGCTTTTCCGGCCGTTCAACTCTACCCAGGCCGAGGAGTTCCTAGGTTCTCAAAGCCCAGGCGA
CGTTGTTATTCGCCCGTCCTCCCGAGGTCCCGATCACTTAGCTGTCACCTGGAAGGTGGCGCAAGGTGTGTACCA
GCACATCGATGTTCTCGAGCTGGACAAAGAGAACGAGTTCTCTGTCGGCCGTGTCCTCAAGGTCGGTGGTCGGTA
TACTTATAGTGACCTGGACGACCTGATCGTCAATCACGTCAAAGCGATGGCCAAGAAGGTGGGCGAGATGGTATT
CCACGAGAAATTCCAAGAAGGCAGCAAGGCCGAGACAGGTATGTTTTTGATAATTTATCCCATCTAACTAGCATC
CGACTAACATCTAATAGATCAATGGCTCGATACTTATACCAAGGCCAACCCTCGCCGCTCGGCATATGCATTCTG
CATCAACCCCAAATACCCCGGTTACTTTTATCTTTGCTTCAAGGCAGGCGAGCATGCACGACTTCAAAACTGGCC
GGTCAAGGTGATTCCCCAGGGCTACGAACTGCAGAAGAACCCCTACCCGGACATGAACGCTCTATGCAACGGCTT
TAAGCTGATGTTTAGCAACATGAGCAAGGGCAACCGGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail