Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6866.t1
Gene name
Locationscaffold_19:222949..229108
Strand-
Gene length (bp)6159
Transcript length (bp)6159
Coding sequence length (bp)6159
Protein length (aa) 2053

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12859 ANAPC1 Anaphase-promoting complex subunit 1 2.9E-33 145 266

GO

GO Term Description Terminal node
GO:0005680 anaphase-promoting complex Yes
GO:1902494 catalytic complex No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:1990234 transferase complex No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005575 cellular_component No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0044422 organelle part No
GO:0044428 nuclear part No
GO:0044446 intracellular organelle part No
GO:0044464 cell part No
GO:0000151 ubiquitin ligase complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6866.t1
MASVRSLGVHEPSAISYLVAEGILPQEPSEDHYNWTLCVDESGLTGPVDDELVWTKHCVVWSRAGMVKRVFRMDP
EKEEIRHALFTRFAAEDTKRAKPTPPSRPEATTGTQKQKRTETFSTLDLHGDARVAVVAPQHSNEALSRALVVVL
KSQAHIFFVAGNSHTIPLPFEVDSVFATPRGLIFQRKVQNENSSSQQPTAPPNSFVSSLFDPGASQSFSLSKNKR
PSTKSSSAPGPSWVPNTASSTDLPRVFSLINPHSEMGLVVTSQTSRWLQSSITSTRKRPSGLEVLDPVDEIVYIS
PKDELSGINRPNSGPLILVVTINTTTGIYTVWTAHYKDDESGGSMKDKTRRETGGTRSVRRSSHFGMATGATTPA
ARSGAGRESFGPRTDNWPSTQLSEGRNDAEDDLASRVAQDFGDVGVPLKTSRRVSSLLARTDLATSQDRITFSDL
ATGSQSSNMPHGAGFRQSLGASMRGSFGFNPRGSLPPGTGSVYSTAGSFLDTPVDKLLEELNNDSLSSGFDNIAL
RESTSGLPEELILTKVESFSSQFSGSFQKEPASRRLKISTLASTEFGSAHKGNTTFLAVYIVDQEARKLTIVNLR
ADRQPAPKNRKKKSKTSLLVRAVRIQNVSNVLDACRISDGDLSRILSLSETESGQRELSLQTLWGSPVKVEVPIP
LQLYEPDGISANKLESRPRESGVHRVMADPSLVFNKFDHGCSRGKVDLVDTDKKRHRLQIRMEPRNELVKKILKI
CMFALRESEKAGDGITVAWWEVMKWLRGKEEDNIEWTAMTVVLLSLAAPFVTPPQTQTPKRTRRKKGLLRSSSGG
HLDLESWESMLDLESGSSGVVAPWMMDGSWGWIVEQDAIESLASGDAPKGVNASRSTYRQNSYLIRCIALSREFL
QSPEGLRAAGRDGYLPISEAFSENTRCTALCSVLVALHLLREEQKLSTCDSEESQRPLGLLAPVIAQLGSWLGWE
SWTWAEDAYYGTEMASMERWQFEDNTHIAGLKVPAEPFPPPSIFEFLMGAAAHRSPTPFVSLLDIVNAAERTPRK
GRMWRECFGITPRTCALNGFFTEVHSVSTPLEKIKLLQRWGFTKSVIDSFPEGVSAPLYEAVMQCQIEASTSWNA
TLLEMIDREDLYMSMNPAQPSSLAAPQQPNHNAVRDFHYISSSALDIDATNAFEASAEADRYSVTRLIFREDKRF
VEAGKLLNQSKAPVAECIAEPGWSDSDLLEAQKEIVQLVTVRTLSTPAGRAMLTFSGRLPLLTEKLPIPSFSLQC
VMKPDNVTVSADKSAFSEEKVCWAFFHNGVSTGLAISKASKGIDTSWILFNKPQDLTNRHAGFLLALGLNGHLKS
LAKWVAFKYLTPKHTMTSIGLLLGLSASYLGTMDTLITRLLSVHVTRMLPFGAAELNLSPLTQTAGIMGIGLLYC
GSQHRRMSEVMLSEIENSEQDEQAAATGEELRDEGYRLAAGFALGFINLGKGDDLRGMRDMHIVERLLSIAVGTK
TVEIAHVLDRATAGATIALMIIFMKTNDSVLAKKIDIPDTTVRFDYVRPDIFLLRTLARHLIMWDSIKPTAEWIS
QSLPEVYRGRSQLSEVRRLRSEDMPFFNIIAGLCFAVGLRHAGSGQAQARDLLLFYLDQLIRISRLPVRSYDARL
ARNSVRNCQDLVALSAAAVMAGTGDLALFRRLRSLHGRIDADTPYGSHMAAHMAIGVLFLGGGSYTLGTSNRAVT
ALICAFYPIFPTTVLDNKCHLQAFRHLWVLAAEPRCLIPRDLDSRRPISIPITITSHDETTRTVSAPCLLPDLSS
IARIEIRGPDHWPLVLDFSQNDALREKFLRGDPSIYLRRKATYSPSSSTSVFASTLTGLSEAQDILPATAGPLSN
PAKGLPPSAWPTRMALLTGKASTLITPSQTPWDWVFHLPSLQDLDIRERSLVLPSSFPMRSVRITTDLVSVPPWL
RTSAVDARLALSHTVRNIVQSARGRGADPDQIRDRIWQLRLLFDWLDRTQPGDERDHLSSRGLLSSTQGQPSGLW
LRRDFVEEAKWQVWGVQVGDLEGENQI*
Coding >Pro_DTO377G3_2|g6866.t1
ATGGCGTCAGTTCGCTCTTTGGGCGTCCACGAACCCTCGGCCATCTCCTACTTAGTCGCAGAGGGAATTCTCCCT
CAGGAACCTTCAGAAGACCATTACAACTGGACGCTATGCGTGGACGAAAGCGGATTGACTGGCCCGGTGGACGAT
GAGTTAGTATGGACGAAACACTGTGTTGTATGGTCCCGCGCAGGGATGGTGAAGCGAGTATTTCGAATGGACCCC
GAGAAAGAAGAGATTCGACATGCTCTATTCACTCGTTTTGCCGCTGAAGACACGAAACGCGCCAAACCCACGCCT
CCAAGTCGACCTGAAGCAACTACTGGCACGCAGAAACAAAAGCGGACTGAAACCTTCTCAACATTGGATCTACAT
GGAGATGCACGAGTGGCGGTTGTAGCTCCCCAGCACTCTAACGAGGCTCTTTCTAGAGCGTTGGTGGTAGTTCTC
AAATCGCAAGCTCATATCTTCTTCGTGGCGGGCAATAGTCATACAATTCCCCTCCCATTTGAGGTTGACTCCGTC
TTCGCTACGCCTCGGGGTCTTATTTTCCAAAGAAAGGTCCAGAATGAAAATAGTAGCAGTCAACAACCGACTGCG
CCGCCTAATTCCTTCGTGTCTTCGCTATTTGATCCCGGTGCCTCTCAGTCATTTTCTCTCAGCAAAAACAAGCGT
CCATCGACGAAATCCTCGTCTGCTCCAGGTCCTTCCTGGGTGCCAAATACCGCCTCAAGCACCGACCTACCCCGA
GTTTTCTCTCTCATTAATCCTCATTCCGAGATGGGCTTAGTTGTGACGTCGCAAACTTCCCGCTGGCTTCAGAGC
AGCATCACTAGCACCAGAAAAAGGCCGTCTGGACTAGAGGTGCTGGACCCTGTGGATGAGATTGTGTATATCTCT
CCAAAAGACGAACTCTCGGGCATCAACAGACCAAATAGTGGTCCTTTGATCCTAGTCGTTACCATCAACACAACT
ACAGGTATTTATACAGTCTGGACTGCGCACTACAAAGATGATGAATCAGGCGGCTCGATGAAAGATAAAACCAGA
CGGGAAACAGGAGGTACCCGGTCAGTAAGGCGAAGCTCACATTTCGGGATGGCGACTGGCGCGACAACACCAGCC
GCTCGTTCTGGAGCAGGCCGAGAGAGCTTCGGGCCTCGAACTGACAACTGGCCTTCCACTCAGTTATCTGAAGGG
AGAAATGATGCCGAAGACGACTTGGCTTCGAGAGTAGCCCAAGACTTCGGAGATGTCGGTGTTCCCCTCAAAACA
TCGAGGCGAGTCAGCTCACTGCTCGCCCGAACAGACCTTGCAACTAGCCAGGACCGTATCACTTTTTCGGACCTG
GCTACTGGCAGTCAGTCCAGCAACATGCCTCATGGTGCTGGGTTCAGGCAATCTCTCGGAGCAAGCATGCGTGGA
AGCTTTGGTTTCAATCCTCGAGGCTCTCTACCTCCAGGCACAGGGTCTGTTTACAGCACTGCAGGCAGCTTTCTG
GATACTCCAGTGGACAAGCTACTCGAAGAGCTTAACAATGACAGTCTATCTTCCGGGTTTGATAACATTGCCCTA
CGTGAATCGACGTCCGGACTCCCGGAAGAACTTATATTGACCAAGGTTGAAAGTTTCTCGTCCCAATTCTCGGGC
AGCTTCCAAAAAGAGCCAGCATCTCGCCGGTTGAAGATCTCTACATTGGCATCCACCGAGTTTGGAAGCGCCCAC
AAAGGCAACACAACTTTCCTAGCTGTATACATCGTGGACCAGGAGGCACGGAAATTAACTATTGTGAATCTGAGG
GCCGACCGACAGCCAGCCCCCAAGAACCGGAAGAAAAAGTCCAAGACCTCATTACTCGTGCGTGCGGTTAGGATC
CAAAATGTGTCAAACGTTTTGGATGCTTGTAGAATCTCTGATGGGGATCTTTCGCGAATACTCTCACTAAGCGAA
ACAGAAAGTGGACAACGCGAGCTATCATTGCAAACCCTGTGGGGTAGTCCCGTCAAAGTTGAGGTTCCTATTCCA
CTGCAGCTGTATGAACCGGATGGCATCTCTGCCAACAAACTCGAGAGTCGCCCAAGAGAAAGTGGCGTCCACCGA
GTCATGGCAGATCCCAGCCTCGTCTTCAACAAGTTTGATCATGGGTGCTCCCGCGGGAAAGTCGACCTGGTAGAC
ACTGATAAAAAGCGCCACAGACTCCAAATTCGAATGGAGCCTCGCAATGAACTGGTGAAGAAAATACTCAAAATC
TGCATGTTTGCCTTGCGTGAGTCTGAGAAAGCGGGCGATGGCATCACGGTCGCATGGTGGGAGGTCATGAAATGG
CTTCGAGGCAAAGAGGAAGACAACATTGAATGGACCGCCATGACAGTCGTCTTGTTGAGTCTAGCAGCCCCATTC
GTCACCCCTCCACAAACGCAGACTCCCAAACGAACGCGTCGCAAAAAGGGTCTACTTAGATCAAGTAGTGGAGGA
CACCTGGATCTGGAAAGCTGGGAGTCCATGCTGGACCTGGAGTCTGGCTCATCCGGCGTCGTAGCTCCGTGGATG
ATGGACGGTTCCTGGGGATGGATCGTTGAACAAGATGCAATTGAGAGTCTCGCGTCAGGAGACGCACCCAAGGGT
GTCAATGCAAGTCGGTCTACATATCGCCAGAATTCGTACTTGATCCGGTGCATCGCCCTCAGCCGCGAATTCCTC
CAGAGTCCCGAAGGCCTCAGGGCTGCTGGCCGAGACGGCTATCTCCCTATCTCTGAAGCATTCTCGGAAAACACA
AGATGTACCGCATTGTGCAGTGTTCTTGTAGCCTTGCATCTATTGCGAGAAGAACAGAAGCTCTCCACCTGCGAC
TCGGAGGAATCCCAAAGACCTCTAGGTTTGCTTGCTCCCGTTATCGCACAACTGGGCAGCTGGCTAGGATGGGAA
TCATGGACATGGGCCGAGGATGCATATTATGGCACCGAAATGGCCAGTATGGAGCGCTGGCAGTTTGAGGATAAT
ACACATATCGCTGGGCTGAAGGTTCCCGCCGAACCCTTTCCGCCTCCGTCCATCTTCGAATTTCTCATGGGAGCT
GCTGCTCATCGGAGCCCCACACCATTTGTTTCTCTCCTTGATATTGTGAATGCAGCCGAGCGAACTCCCAGGAAA
GGGCGAATGTGGCGTGAATGTTTCGGTATCACACCAAGGACGTGTGCGTTGAATGGATTCTTCACCGAGGTTCAC
AGTGTATCGACGCCCTTGGAAAAAATCAAGCTTTTGCAGCGTTGGGGCTTCACAAAGAGTGTCATTGATAGCTTC
CCAGAAGGCGTCAGTGCCCCGCTCTATGAAGCCGTCATGCAATGCCAGATTGAAGCCTCCACGTCCTGGAACGCC
ACGCTCCTAGAAATGATTGACAGAGAAGACCTTTACATGTCGATGAACCCGGCCCAACCCAGTTCATTGGCAGCG
CCGCAGCAGCCCAATCATAATGCCGTCCGGGATTTCCATTATATCAGCAGCTCAGCATTGGATATTGATGCCACC
AATGCGTTTGAGGCTTCTGCAGAGGCTGACCGATACTCGGTCACCAGGCTGATATTCCGAGAGGATAAGCGATTT
GTGGAAGCAGGTAAACTACTAAACCAGTCCAAAGCACCGGTGGCAGAGTGCATAGCCGAACCTGGCTGGAGTGAT
TCGGACTTGTTAGAGGCGCAGAAAGAAATCGTGCAGCTCGTGACAGTCCGGACGTTGTCTACTCCAGCGGGTCGT
GCAATGCTCACTTTTAGTGGCCGATTGCCTTTGTTGACTGAGAAACTGCCCATCCCTTCATTTTCCCTGCAGTGT
GTCATGAAGCCAGACAATGTGACTGTCAGCGCAGATAAATCTGCGTTCTCGGAAGAAAAGGTCTGCTGGGCCTTC
TTCCACAACGGAGTCTCAACCGGTCTGGCAATCTCCAAGGCGTCGAAGGGTATTGATACGTCGTGGATATTGTTC
AACAAGCCACAGGATCTTACCAACCGTCATGCCGGGTTCTTGTTGGCTCTGGGTCTGAATGGCCATCTTAAATCG
TTGGCTAAGTGGGTAGCTTTCAAGTACCTCACTCCAAAGCATACCATGACATCAATTGGTCTCCTGCTCGGTCTC
TCTGCGTCATACTTGGGCACAATGGATACTCTAATCACACGCTTGCTTTCGGTACATGTTACAAGAATGCTTCCA
TTTGGAGCAGCTGAGCTGAACCTGTCACCGTTGACTCAGACTGCTGGAATTATGGGTATCGGTTTACTTTACTGT
GGCTCCCAGCATCGTCGTATGAGCGAGGTCATGCTCTCGGAAATCGAGAACAGTGAGCAGGACGAGCAAGCTGCT
GCTACCGGAGAAGAACTCCGCGACGAAGGATATCGTCTGGCCGCAGGCTTTGCCCTCGGTTTCATTAACCTTGGC
AAAGGCGATGACTTGCGGGGCATGCGCGATATGCACATTGTTGAACGGCTATTGTCAATAGCCGTGGGTACCAAG
ACCGTCGAAATCGCTCATGTACTCGACCGCGCCACGGCTGGCGCGACCATTGCTCTCATGATTATCTTCATGAAG
ACGAATGACTCGGTACTAGCGAAGAAGATTGACATTCCTGATACCACTGTTCGCTTCGACTACGTGAGGCCAGAT
ATCTTCCTGTTACGAACACTGGCACGACACTTGATCATGTGGGATAGTATCAAGCCCACTGCTGAGTGGATCAGC
CAGAGTCTGCCCGAAGTCTACCGGGGACGATCCCAACTCAGCGAGGTGCGCCGGCTGCGCAGCGAAGATATGCCA
TTCTTCAACATTATTGCAGGCCTCTGCTTTGCGGTCGGTCTCCGCCATGCTGGATCGGGACAAGCACAGGCCCGA
GATCTTTTGTTGTTTTATCTAGACCAGCTTATCCGCATCTCACGGCTGCCTGTGCGAAGCTACGATGCTAGACTC
GCCCGCAATTCGGTTCGGAATTGTCAAGACTTGGTAGCCCTATCTGCTGCGGCAGTCATGGCCGGCACGGGTGAT
CTAGCTCTGTTCCGGCGCCTGCGCTCGCTCCATGGTCGAATCGACGCTGATACACCATATGGCAGTCACATGGCG
GCACACATGGCTATCGGAGTGCTCTTCCTTGGAGGAGGTAGCTATACACTTGGCACATCCAACCGGGCTGTGACC
GCGCTTATATGCGCATTCTACCCTATCTTCCCAACGACTGTCCTTGATAACAAATGCCATCTCCAAGCCTTCCGC
CATCTTTGGGTTCTCGCCGCTGAACCACGATGCCTCATCCCTCGTGATCTTGATTCCCGCCGCCCAATTTCGATC
CCCATTACCATCACTTCTCACGACGAGACAACCCGCACCGTCAGCGCTCCCTGTCTACTGCCAGATCTTAGCAGC
ATCGCCCGTATCGAGATTCGCGGACCAGACCACTGGCCGCTCGTTCTAGATTTCAGCCAGAATGATGCCCTGCGC
GAGAAATTCCTCCGCGGCGACCCATCCATCTATCTTCGCCGCAAGGCAACCTACAGTCCAAGCTCCTCAACCTCC
GTATTCGCCTCCACCCTGACCGGGCTCAGCGAAGCCCAAGACATCCTCCCAGCAACGGCTGGTCCCCTCTCAAAC
CCAGCCAAGGGCCTGCCACCCTCAGCATGGCCAACCCGCATGGCCCTACTCACCGGTAAGGCATCTACATTGATA
ACTCCGTCCCAAACCCCCTGGGACTGGGTCTTCCACCTCCCATCCCTACAAGACCTCGATATACGCGAGCGCTCC
CTCGTCCTCCCATCTTCCTTCCCGATGCGCTCCGTGCGCATCACCACCGATCTTGTCTCCGTCCCACCTTGGCTG
CGTACCTCAGCTGTAGATGCGAGACTCGCTCTGTCCCACACCGTGCGCAACATCGTGCAATCTGCACGCGGTCGC
GGCGCTGATCCGGACCAAATTCGTGATCGGATCTGGCAGCTTCGTTTGCTATTTGATTGGCTGGATCGTACTCAG
CCCGGCGATGAACGCGACCATCTTTCGAGTAGAGGGCTGCTTTCTTCGACGCAGGGTCAGCCGTCTGGGCTGTGG
TTGCGGAGGGACTTTGTTGAAGAAGCTAAGTGGCAAGTTTGGGGTGTTCAGGTCGGAGATCTTGAGGGAGAGAAC
CAGATATAA
Transcript >Pro_DTO377G3_2|g6866.t1
ATGGCGTCAGTTCGCTCTTTGGGCGTCCACGAACCCTCGGCCATCTCCTACTTAGTCGCAGAGGGAATTCTCCCT
CAGGAACCTTCAGAAGACCATTACAACTGGACGCTATGCGTGGACGAAAGCGGATTGACTGGCCCGGTGGACGAT
GAGTTAGTATGGACGAAACACTGTGTTGTATGGTCCCGCGCAGGGATGGTGAAGCGAGTATTTCGAATGGACCCC
GAGAAAGAAGAGATTCGACATGCTCTATTCACTCGTTTTGCCGCTGAAGACACGAAACGCGCCAAACCCACGCCT
CCAAGTCGACCTGAAGCAACTACTGGCACGCAGAAACAAAAGCGGACTGAAACCTTCTCAACATTGGATCTACAT
GGAGATGCACGAGTGGCGGTTGTAGCTCCCCAGCACTCTAACGAGGCTCTTTCTAGAGCGTTGGTGGTAGTTCTC
AAATCGCAAGCTCATATCTTCTTCGTGGCGGGCAATAGTCATACAATTCCCCTCCCATTTGAGGTTGACTCCGTC
TTCGCTACGCCTCGGGGTCTTATTTTCCAAAGAAAGGTCCAGAATGAAAATAGTAGCAGTCAACAACCGACTGCG
CCGCCTAATTCCTTCGTGTCTTCGCTATTTGATCCCGGTGCCTCTCAGTCATTTTCTCTCAGCAAAAACAAGCGT
CCATCGACGAAATCCTCGTCTGCTCCAGGTCCTTCCTGGGTGCCAAATACCGCCTCAAGCACCGACCTACCCCGA
GTTTTCTCTCTCATTAATCCTCATTCCGAGATGGGCTTAGTTGTGACGTCGCAAACTTCCCGCTGGCTTCAGAGC
AGCATCACTAGCACCAGAAAAAGGCCGTCTGGACTAGAGGTGCTGGACCCTGTGGATGAGATTGTGTATATCTCT
CCAAAAGACGAACTCTCGGGCATCAACAGACCAAATAGTGGTCCTTTGATCCTAGTCGTTACCATCAACACAACT
ACAGGTATTTATACAGTCTGGACTGCGCACTACAAAGATGATGAATCAGGCGGCTCGATGAAAGATAAAACCAGA
CGGGAAACAGGAGGTACCCGGTCAGTAAGGCGAAGCTCACATTTCGGGATGGCGACTGGCGCGACAACACCAGCC
GCTCGTTCTGGAGCAGGCCGAGAGAGCTTCGGGCCTCGAACTGACAACTGGCCTTCCACTCAGTTATCTGAAGGG
AGAAATGATGCCGAAGACGACTTGGCTTCGAGAGTAGCCCAAGACTTCGGAGATGTCGGTGTTCCCCTCAAAACA
TCGAGGCGAGTCAGCTCACTGCTCGCCCGAACAGACCTTGCAACTAGCCAGGACCGTATCACTTTTTCGGACCTG
GCTACTGGCAGTCAGTCCAGCAACATGCCTCATGGTGCTGGGTTCAGGCAATCTCTCGGAGCAAGCATGCGTGGA
AGCTTTGGTTTCAATCCTCGAGGCTCTCTACCTCCAGGCACAGGGTCTGTTTACAGCACTGCAGGCAGCTTTCTG
GATACTCCAGTGGACAAGCTACTCGAAGAGCTTAACAATGACAGTCTATCTTCCGGGTTTGATAACATTGCCCTA
CGTGAATCGACGTCCGGACTCCCGGAAGAACTTATATTGACCAAGGTTGAAAGTTTCTCGTCCCAATTCTCGGGC
AGCTTCCAAAAAGAGCCAGCATCTCGCCGGTTGAAGATCTCTACATTGGCATCCACCGAGTTTGGAAGCGCCCAC
AAAGGCAACACAACTTTCCTAGCTGTATACATCGTGGACCAGGAGGCACGGAAATTAACTATTGTGAATCTGAGG
GCCGACCGACAGCCAGCCCCCAAGAACCGGAAGAAAAAGTCCAAGACCTCATTACTCGTGCGTGCGGTTAGGATC
CAAAATGTGTCAAACGTTTTGGATGCTTGTAGAATCTCTGATGGGGATCTTTCGCGAATACTCTCACTAAGCGAA
ACAGAAAGTGGACAACGCGAGCTATCATTGCAAACCCTGTGGGGTAGTCCCGTCAAAGTTGAGGTTCCTATTCCA
CTGCAGCTGTATGAACCGGATGGCATCTCTGCCAACAAACTCGAGAGTCGCCCAAGAGAAAGTGGCGTCCACCGA
GTCATGGCAGATCCCAGCCTCGTCTTCAACAAGTTTGATCATGGGTGCTCCCGCGGGAAAGTCGACCTGGTAGAC
ACTGATAAAAAGCGCCACAGACTCCAAATTCGAATGGAGCCTCGCAATGAACTGGTGAAGAAAATACTCAAAATC
TGCATGTTTGCCTTGCGTGAGTCTGAGAAAGCGGGCGATGGCATCACGGTCGCATGGTGGGAGGTCATGAAATGG
CTTCGAGGCAAAGAGGAAGACAACATTGAATGGACCGCCATGACAGTCGTCTTGTTGAGTCTAGCAGCCCCATTC
GTCACCCCTCCACAAACGCAGACTCCCAAACGAACGCGTCGCAAAAAGGGTCTACTTAGATCAAGTAGTGGAGGA
CACCTGGATCTGGAAAGCTGGGAGTCCATGCTGGACCTGGAGTCTGGCTCATCCGGCGTCGTAGCTCCGTGGATG
ATGGACGGTTCCTGGGGATGGATCGTTGAACAAGATGCAATTGAGAGTCTCGCGTCAGGAGACGCACCCAAGGGT
GTCAATGCAAGTCGGTCTACATATCGCCAGAATTCGTACTTGATCCGGTGCATCGCCCTCAGCCGCGAATTCCTC
CAGAGTCCCGAAGGCCTCAGGGCTGCTGGCCGAGACGGCTATCTCCCTATCTCTGAAGCATTCTCGGAAAACACA
AGATGTACCGCATTGTGCAGTGTTCTTGTAGCCTTGCATCTATTGCGAGAAGAACAGAAGCTCTCCACCTGCGAC
TCGGAGGAATCCCAAAGACCTCTAGGTTTGCTTGCTCCCGTTATCGCACAACTGGGCAGCTGGCTAGGATGGGAA
TCATGGACATGGGCCGAGGATGCATATTATGGCACCGAAATGGCCAGTATGGAGCGCTGGCAGTTTGAGGATAAT
ACACATATCGCTGGGCTGAAGGTTCCCGCCGAACCCTTTCCGCCTCCGTCCATCTTCGAATTTCTCATGGGAGCT
GCTGCTCATCGGAGCCCCACACCATTTGTTTCTCTCCTTGATATTGTGAATGCAGCCGAGCGAACTCCCAGGAAA
GGGCGAATGTGGCGTGAATGTTTCGGTATCACACCAAGGACGTGTGCGTTGAATGGATTCTTCACCGAGGTTCAC
AGTGTATCGACGCCCTTGGAAAAAATCAAGCTTTTGCAGCGTTGGGGCTTCACAAAGAGTGTCATTGATAGCTTC
CCAGAAGGCGTCAGTGCCCCGCTCTATGAAGCCGTCATGCAATGCCAGATTGAAGCCTCCACGTCCTGGAACGCC
ACGCTCCTAGAAATGATTGACAGAGAAGACCTTTACATGTCGATGAACCCGGCCCAACCCAGTTCATTGGCAGCG
CCGCAGCAGCCCAATCATAATGCCGTCCGGGATTTCCATTATATCAGCAGCTCAGCATTGGATATTGATGCCACC
AATGCGTTTGAGGCTTCTGCAGAGGCTGACCGATACTCGGTCACCAGGCTGATATTCCGAGAGGATAAGCGATTT
GTGGAAGCAGGTAAACTACTAAACCAGTCCAAAGCACCGGTGGCAGAGTGCATAGCCGAACCTGGCTGGAGTGAT
TCGGACTTGTTAGAGGCGCAGAAAGAAATCGTGCAGCTCGTGACAGTCCGGACGTTGTCTACTCCAGCGGGTCGT
GCAATGCTCACTTTTAGTGGCCGATTGCCTTTGTTGACTGAGAAACTGCCCATCCCTTCATTTTCCCTGCAGTGT
GTCATGAAGCCAGACAATGTGACTGTCAGCGCAGATAAATCTGCGTTCTCGGAAGAAAAGGTCTGCTGGGCCTTC
TTCCACAACGGAGTCTCAACCGGTCTGGCAATCTCCAAGGCGTCGAAGGGTATTGATACGTCGTGGATATTGTTC
AACAAGCCACAGGATCTTACCAACCGTCATGCCGGGTTCTTGTTGGCTCTGGGTCTGAATGGCCATCTTAAATCG
TTGGCTAAGTGGGTAGCTTTCAAGTACCTCACTCCAAAGCATACCATGACATCAATTGGTCTCCTGCTCGGTCTC
TCTGCGTCATACTTGGGCACAATGGATACTCTAATCACACGCTTGCTTTCGGTACATGTTACAAGAATGCTTCCA
TTTGGAGCAGCTGAGCTGAACCTGTCACCGTTGACTCAGACTGCTGGAATTATGGGTATCGGTTTACTTTACTGT
GGCTCCCAGCATCGTCGTATGAGCGAGGTCATGCTCTCGGAAATCGAGAACAGTGAGCAGGACGAGCAAGCTGCT
GCTACCGGAGAAGAACTCCGCGACGAAGGATATCGTCTGGCCGCAGGCTTTGCCCTCGGTTTCATTAACCTTGGC
AAAGGCGATGACTTGCGGGGCATGCGCGATATGCACATTGTTGAACGGCTATTGTCAATAGCCGTGGGTACCAAG
ACCGTCGAAATCGCTCATGTACTCGACCGCGCCACGGCTGGCGCGACCATTGCTCTCATGATTATCTTCATGAAG
ACGAATGACTCGGTACTAGCGAAGAAGATTGACATTCCTGATACCACTGTTCGCTTCGACTACGTGAGGCCAGAT
ATCTTCCTGTTACGAACACTGGCACGACACTTGATCATGTGGGATAGTATCAAGCCCACTGCTGAGTGGATCAGC
CAGAGTCTGCCCGAAGTCTACCGGGGACGATCCCAACTCAGCGAGGTGCGCCGGCTGCGCAGCGAAGATATGCCA
TTCTTCAACATTATTGCAGGCCTCTGCTTTGCGGTCGGTCTCCGCCATGCTGGATCGGGACAAGCACAGGCCCGA
GATCTTTTGTTGTTTTATCTAGACCAGCTTATCCGCATCTCACGGCTGCCTGTGCGAAGCTACGATGCTAGACTC
GCCCGCAATTCGGTTCGGAATTGTCAAGACTTGGTAGCCCTATCTGCTGCGGCAGTCATGGCCGGCACGGGTGAT
CTAGCTCTGTTCCGGCGCCTGCGCTCGCTCCATGGTCGAATCGACGCTGATACACCATATGGCAGTCACATGGCG
GCACACATGGCTATCGGAGTGCTCTTCCTTGGAGGAGGTAGCTATACACTTGGCACATCCAACCGGGCTGTGACC
GCGCTTATATGCGCATTCTACCCTATCTTCCCAACGACTGTCCTTGATAACAAATGCCATCTCCAAGCCTTCCGC
CATCTTTGGGTTCTCGCCGCTGAACCACGATGCCTCATCCCTCGTGATCTTGATTCCCGCCGCCCAATTTCGATC
CCCATTACCATCACTTCTCACGACGAGACAACCCGCACCGTCAGCGCTCCCTGTCTACTGCCAGATCTTAGCAGC
ATCGCCCGTATCGAGATTCGCGGACCAGACCACTGGCCGCTCGTTCTAGATTTCAGCCAGAATGATGCCCTGCGC
GAGAAATTCCTCCGCGGCGACCCATCCATCTATCTTCGCCGCAAGGCAACCTACAGTCCAAGCTCCTCAACCTCC
GTATTCGCCTCCACCCTGACCGGGCTCAGCGAAGCCCAAGACATCCTCCCAGCAACGGCTGGTCCCCTCTCAAAC
CCAGCCAAGGGCCTGCCACCCTCAGCATGGCCAACCCGCATGGCCCTACTCACCGGTAAGGCATCTACATTGATA
ACTCCGTCCCAAACCCCCTGGGACTGGGTCTTCCACCTCCCATCCCTACAAGACCTCGATATACGCGAGCGCTCC
CTCGTCCTCCCATCTTCCTTCCCGATGCGCTCCGTGCGCATCACCACCGATCTTGTCTCCGTCCCACCTTGGCTG
CGTACCTCAGCTGTAGATGCGAGACTCGCTCTGTCCCACACCGTGCGCAACATCGTGCAATCTGCACGCGGTCGC
GGCGCTGATCCGGACCAAATTCGTGATCGGATCTGGCAGCTTCGTTTGCTATTTGATTGGCTGGATCGTACTCAG
CCCGGCGATGAACGCGACCATCTTTCGAGTAGAGGGCTGCTTTCTTCGACGCAGGGTCAGCCGTCTGGGCTGTGG
TTGCGGAGGGACTTTGTTGAAGAAGCTAAGTGGCAAGTTTGGGGTGTTCAGGTCGGAGATCTTGAGGGAGAGAAC
CAGATATAA
Gene >Pro_DTO377G3_2|g6866.t1
ATGGCGTCAGTTCGCTCTTTGGGCGTCCACGAACCCTCGGCCATCTCCTACTTAGTCGCAGAGGGAATTCTCCCT
CAGGAACCTTCAGAAGACCATTACAACTGGACGCTATGCGTGGACGAAAGCGGATTGACTGGCCCGGTGGACGAT
GAGTTAGTATGGACGAAACACTGTGTTGTATGGTCCCGCGCAGGGATGGTGAAGCGAGTATTTCGAATGGACCCC
GAGAAAGAAGAGATTCGACATGCTCTATTCACTCGTTTTGCCGCTGAAGACACGAAACGCGCCAAACCCACGCCT
CCAAGTCGACCTGAAGCAACTACTGGCACGCAGAAACAAAAGCGGACTGAAACCTTCTCAACATTGGATCTACAT
GGAGATGCACGAGTGGCGGTTGTAGCTCCCCAGCACTCTAACGAGGCTCTTTCTAGAGCGTTGGTGGTAGTTCTC
AAATCGCAAGCTCATATCTTCTTCGTGGCGGGCAATAGTCATACAATTCCCCTCCCATTTGAGGTTGACTCCGTC
TTCGCTACGCCTCGGGGTCTTATTTTCCAAAGAAAGGTCCAGAATGAAAATAGTAGCAGTCAACAACCGACTGCG
CCGCCTAATTCCTTCGTGTCTTCGCTATTTGATCCCGGTGCCTCTCAGTCATTTTCTCTCAGCAAAAACAAGCGT
CCATCGACGAAATCCTCGTCTGCTCCAGGTCCTTCCTGGGTGCCAAATACCGCCTCAAGCACCGACCTACCCCGA
GTTTTCTCTCTCATTAATCCTCATTCCGAGATGGGCTTAGTTGTGACGTCGCAAACTTCCCGCTGGCTTCAGAGC
AGCATCACTAGCACCAGAAAAAGGCCGTCTGGACTAGAGGTGCTGGACCCTGTGGATGAGATTGTGTATATCTCT
CCAAAAGACGAACTCTCGGGCATCAACAGACCAAATAGTGGTCCTTTGATCCTAGTCGTTACCATCAACACAACT
ACAGGTATTTATACAGTCTGGACTGCGCACTACAAAGATGATGAATCAGGCGGCTCGATGAAAGATAAAACCAGA
CGGGAAACAGGAGGTACCCGGTCAGTAAGGCGAAGCTCACATTTCGGGATGGCGACTGGCGCGACAACACCAGCC
GCTCGTTCTGGAGCAGGCCGAGAGAGCTTCGGGCCTCGAACTGACAACTGGCCTTCCACTCAGTTATCTGAAGGG
AGAAATGATGCCGAAGACGACTTGGCTTCGAGAGTAGCCCAAGACTTCGGAGATGTCGGTGTTCCCCTCAAAACA
TCGAGGCGAGTCAGCTCACTGCTCGCCCGAACAGACCTTGCAACTAGCCAGGACCGTATCACTTTTTCGGACCTG
GCTACTGGCAGTCAGTCCAGCAACATGCCTCATGGTGCTGGGTTCAGGCAATCTCTCGGAGCAAGCATGCGTGGA
AGCTTTGGTTTCAATCCTCGAGGCTCTCTACCTCCAGGCACAGGGTCTGTTTACAGCACTGCAGGCAGCTTTCTG
GATACTCCAGTGGACAAGCTACTCGAAGAGCTTAACAATGACAGTCTATCTTCCGGGTTTGATAACATTGCCCTA
CGTGAATCGACGTCCGGACTCCCGGAAGAACTTATATTGACCAAGGTTGAAAGTTTCTCGTCCCAATTCTCGGGC
AGCTTCCAAAAAGAGCCAGCATCTCGCCGGTTGAAGATCTCTACATTGGCATCCACCGAGTTTGGAAGCGCCCAC
AAAGGCAACACAACTTTCCTAGCTGTATACATCGTGGACCAGGAGGCACGGAAATTAACTATTGTGAATCTGAGG
GCCGACCGACAGCCAGCCCCCAAGAACCGGAAGAAAAAGTCCAAGACCTCATTACTCGTGCGTGCGGTTAGGATC
CAAAATGTGTCAAACGTTTTGGATGCTTGTAGAATCTCTGATGGGGATCTTTCGCGAATACTCTCACTAAGCGAA
ACAGAAAGTGGACAACGCGAGCTATCATTGCAAACCCTGTGGGGTAGTCCCGTCAAAGTTGAGGTTCCTATTCCA
CTGCAGCTGTATGAACCGGATGGCATCTCTGCCAACAAACTCGAGAGTCGCCCAAGAGAAAGTGGCGTCCACCGA
GTCATGGCAGATCCCAGCCTCGTCTTCAACAAGTTTGATCATGGGTGCTCCCGCGGGAAAGTCGACCTGGTAGAC
ACTGATAAAAAGCGCCACAGACTCCAAATTCGAATGGAGCCTCGCAATGAACTGGTGAAGAAAATACTCAAAATC
TGCATGTTTGCCTTGCGTGAGTCTGAGAAAGCGGGCGATGGCATCACGGTCGCATGGTGGGAGGTCATGAAATGG
CTTCGAGGCAAAGAGGAAGACAACATTGAATGGACCGCCATGACAGTCGTCTTGTTGAGTCTAGCAGCCCCATTC
GTCACCCCTCCACAAACGCAGACTCCCAAACGAACGCGTCGCAAAAAGGGTCTACTTAGATCAAGTAGTGGAGGA
CACCTGGATCTGGAAAGCTGGGAGTCCATGCTGGACCTGGAGTCTGGCTCATCCGGCGTCGTAGCTCCGTGGATG
ATGGACGGTTCCTGGGGATGGATCGTTGAACAAGATGCAATTGAGAGTCTCGCGTCAGGAGACGCACCCAAGGGT
GTCAATGCAAGTCGGTCTACATATCGCCAGAATTCGTACTTGATCCGGTGCATCGCCCTCAGCCGCGAATTCCTC
CAGAGTCCCGAAGGCCTCAGGGCTGCTGGCCGAGACGGCTATCTCCCTATCTCTGAAGCATTCTCGGAAAACACA
AGATGTACCGCATTGTGCAGTGTTCTTGTAGCCTTGCATCTATTGCGAGAAGAACAGAAGCTCTCCACCTGCGAC
TCGGAGGAATCCCAAAGACCTCTAGGTTTGCTTGCTCCCGTTATCGCACAACTGGGCAGCTGGCTAGGATGGGAA
TCATGGACATGGGCCGAGGATGCATATTATGGCACCGAAATGGCCAGTATGGAGCGCTGGCAGTTTGAGGATAAT
ACACATATCGCTGGGCTGAAGGTTCCCGCCGAACCCTTTCCGCCTCCGTCCATCTTCGAATTTCTCATGGGAGCT
GCTGCTCATCGGAGCCCCACACCATTTGTTTCTCTCCTTGATATTGTGAATGCAGCCGAGCGAACTCCCAGGAAA
GGGCGAATGTGGCGTGAATGTTTCGGTATCACACCAAGGACGTGTGCGTTGAATGGATTCTTCACCGAGGTTCAC
AGTGTATCGACGCCCTTGGAAAAAATCAAGCTTTTGCAGCGTTGGGGCTTCACAAAGAGTGTCATTGATAGCTTC
CCAGAAGGCGTCAGTGCCCCGCTCTATGAAGCCGTCATGCAATGCCAGATTGAAGCCTCCACGTCCTGGAACGCC
ACGCTCCTAGAAATGATTGACAGAGAAGACCTTTACATGTCGATGAACCCGGCCCAACCCAGTTCATTGGCAGCG
CCGCAGCAGCCCAATCATAATGCCGTCCGGGATTTCCATTATATCAGCAGCTCAGCATTGGATATTGATGCCACC
AATGCGTTTGAGGCTTCTGCAGAGGCTGACCGATACTCGGTCACCAGGCTGATATTCCGAGAGGATAAGCGATTT
GTGGAAGCAGGTAAACTACTAAACCAGTCCAAAGCACCGGTGGCAGAGTGCATAGCCGAACCTGGCTGGAGTGAT
TCGGACTTGTTAGAGGCGCAGAAAGAAATCGTGCAGCTCGTGACAGTCCGGACGTTGTCTACTCCAGCGGGTCGT
GCAATGCTCACTTTTAGTGGCCGATTGCCTTTGTTGACTGAGAAACTGCCCATCCCTTCATTTTCCCTGCAGTGT
GTCATGAAGCCAGACAATGTGACTGTCAGCGCAGATAAATCTGCGTTCTCGGAAGAAAAGGTCTGCTGGGCCTTC
TTCCACAACGGAGTCTCAACCGGTCTGGCAATCTCCAAGGCGTCGAAGGGTATTGATACGTCGTGGATATTGTTC
AACAAGCCACAGGATCTTACCAACCGTCATGCCGGGTTCTTGTTGGCTCTGGGTCTGAATGGCCATCTTAAATCG
TTGGCTAAGTGGGTAGCTTTCAAGTACCTCACTCCAAAGCATACCATGACATCAATTGGTCTCCTGCTCGGTCTC
TCTGCGTCATACTTGGGCACAATGGATACTCTAATCACACGCTTGCTTTCGGTACATGTTACAAGAATGCTTCCA
TTTGGAGCAGCTGAGCTGAACCTGTCACCGTTGACTCAGACTGCTGGAATTATGGGTATCGGTTTACTTTACTGT
GGCTCCCAGCATCGTCGTATGAGCGAGGTCATGCTCTCGGAAATCGAGAACAGTGAGCAGGACGAGCAAGCTGCT
GCTACCGGAGAAGAACTCCGCGACGAAGGATATCGTCTGGCCGCAGGCTTTGCCCTCGGTTTCATTAACCTTGGC
AAAGGCGATGACTTGCGGGGCATGCGCGATATGCACATTGTTGAACGGCTATTGTCAATAGCCGTGGGTACCAAG
ACCGTCGAAATCGCTCATGTACTCGACCGCGCCACGGCTGGCGCGACCATTGCTCTCATGATTATCTTCATGAAG
ACGAATGACTCGGTACTAGCGAAGAAGATTGACATTCCTGATACCACTGTTCGCTTCGACTACGTGAGGCCAGAT
ATCTTCCTGTTACGAACACTGGCACGACACTTGATCATGTGGGATAGTATCAAGCCCACTGCTGAGTGGATCAGC
CAGAGTCTGCCCGAAGTCTACCGGGGACGATCCCAACTCAGCGAGGTGCGCCGGCTGCGCAGCGAAGATATGCCA
TTCTTCAACATTATTGCAGGCCTCTGCTTTGCGGTCGGTCTCCGCCATGCTGGATCGGGACAAGCACAGGCCCGA
GATCTTTTGTTGTTTTATCTAGACCAGCTTATCCGCATCTCACGGCTGCCTGTGCGAAGCTACGATGCTAGACTC
GCCCGCAATTCGGTTCGGAATTGTCAAGACTTGGTAGCCCTATCTGCTGCGGCAGTCATGGCCGGCACGGGTGAT
CTAGCTCTGTTCCGGCGCCTGCGCTCGCTCCATGGTCGAATCGACGCTGATACACCATATGGCAGTCACATGGCG
GCACACATGGCTATCGGAGTGCTCTTCCTTGGAGGAGGTAGCTATACACTTGGCACATCCAACCGGGCTGTGACC
GCGCTTATATGCGCATTCTACCCTATCTTCCCAACGACTGTCCTTGATAACAAATGCCATCTCCAAGCCTTCCGC
CATCTTTGGGTTCTCGCCGCTGAACCACGATGCCTCATCCCTCGTGATCTTGATTCCCGCCGCCCAATTTCGATC
CCCATTACCATCACTTCTCACGACGAGACAACCCGCACCGTCAGCGCTCCCTGTCTACTGCCAGATCTTAGCAGC
ATCGCCCGTATCGAGATTCGCGGACCAGACCACTGGCCGCTCGTTCTAGATTTCAGCCAGAATGATGCCCTGCGC
GAGAAATTCCTCCGCGGCGACCCATCCATCTATCTTCGCCGCAAGGCAACCTACAGTCCAAGCTCCTCAACCTCC
GTATTCGCCTCCACCCTGACCGGGCTCAGCGAAGCCCAAGACATCCTCCCAGCAACGGCTGGTCCCCTCTCAAAC
CCAGCCAAGGGCCTGCCACCCTCAGCATGGCCAACCCGCATGGCCCTACTCACCGGTAAGGCATCTACATTGATA
ACTCCGTCCCAAACCCCCTGGGACTGGGTCTTCCACCTCCCATCCCTACAAGACCTCGATATACGCGAGCGCTCC
CTCGTCCTCCCATCTTCCTTCCCGATGCGCTCCGTGCGCATCACCACCGATCTTGTCTCCGTCCCACCTTGGCTG
CGTACCTCAGCTGTAGATGCGAGACTCGCTCTGTCCCACACCGTGCGCAACATCGTGCAATCTGCACGCGGTCGC
GGCGCTGATCCGGACCAAATTCGTGATCGGATCTGGCAGCTTCGTTTGCTATTTGATTGGCTGGATCGTACTCAG
CCCGGCGATGAACGCGACCATCTTTCGAGTAGAGGGCTGCTTTCTTCGACGCAGGGTCAGCCGTCTGGGCTGTGG
TTGCGGAGGGACTTTGTTGAAGAAGCTAAGTGGCAAGTTTGGGGTGTTCAGGTCGGAGATCTTGAGGGAGAGAAC
CAGATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail