Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6851.t1
Gene name
Locationscaffold_19:182693..183545
Strand+
Gene length (bp)852
Transcript length (bp)741
Coding sequence length (bp)741
Protein length (aa) 247

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08657 DASH_Spc34 DASH complex subunit Spc34 8.9E-22 4 99
PF08657 DASH_Spc34 DASH complex subunit Spc34 1.5E-18 80 229

GO

GO Term Description Terminal node
GO:0042729 DASH complex Yes
GO:0008608 attachment of spindle microtubules to kinetochore Yes
GO:0005876 spindle microtubule Yes
GO:0022402 cell cycle process No
GO:0008150 biological_process No
GO:0005874 microtubule No
GO:0099081 supramolecular polymer No
GO:0032991 protein-containing complex No
GO:0009987 cellular process No
GO:0099512 supramolecular fiber No
GO:0099080 supramolecular complex No
GO:0110165 cellular anatomical entity No
GO:0140513 nuclear protein-containing complex No
GO:0099513 polymeric cytoskeletal fiber No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6851.t1
MSLLNSHLEQIRLSSNAIADLPFPPPRIFTTALLGSHDITALIRDTEAHERALFQVDPSTKAHGPQRRATRRGTM
FPAETERESMASRIYSARDKRNQSAVARVLGHDMMEEIKRSAGTSTRGPRGEVNIEVLLRGAEILCNVYPVAGAQ
EKIANLRYRHEMISESIAQLEGRVATNTAELDHMRHSYGDDEDDFPPAPVAQPEIPEVTDEDIERELAEIRGLEQ
RKRRLEERVTGMDRDLGGLIG*
Coding >Pro_DTO377G3_2|g6851.t1
ATGTCATTGCTCAATTCTCACCTAGAACAGATTAGACTCTCTTCCAATGCTATCGCCGATTTGCCGTTCCCTCCC
CCACGTATTTTCACCACTGCACTGCTGGGCTCTCACGATATAACAGCATTGATTCGTGATACCGAAGCCCACGAA
CGAGCACTCTTCCAGGTTGACCCGTCTACCAAAGCCCATGGACCACAAAGACGCGCCACACGACGCGGGACTATG
TTCCCCGCTGAGACCGAAAGGGAGTCAATGGCAAGCCGCATTTATTCAGCGCGGGACAAGCGCAACCAGTCTGCA
GTGGCAAGGGTACTGGGACATGATATGATGGAGGAGATCAAGCGATCAGCGGGCACCTCGACTAGAGGACCCCGC
GGGGAGGTCAACATTGAAGTGCTTCTTCGAGGCGCCGAGATCCTGTGCAATGTTTACCCCGTTGCCGGTGCACAG
GAAAAAATTGCCAACCTTCGCTATCGGCATGAGATGATCAGTGAGTCCATAGCGCAGTTAGAAGGCCGGGTTGCA
ACGAATACTGCAGAACTGGATCATATGAGACACTCTTATGGAGATGATGAAGATGATTTTCCCCCTGCACCGGTG
GCACAGCCAGAGATTCCAGAGGTCACTGATGAGGATATTGAACGGGAGTTGGCTGAAATCCGGGGCTTGGAGCAG
AGGAAGCGAAGGCTCGAAGAACGGGTTACAGGCATGGATCGAGATTTGGGTGGTTTGATAGGCTGA
Transcript >Pro_DTO377G3_2|g6851.t1
ATGTCATTGCTCAATTCTCACCTAGAACAGATTAGACTCTCTTCCAATGCTATCGCCGATTTGCCGTTCCCTCCC
CCACGTATTTTCACCACTGCACTGCTGGGCTCTCACGATATAACAGCATTGATTCGTGATACCGAAGCCCACGAA
CGAGCACTCTTCCAGGTTGACCCGTCTACCAAAGCCCATGGACCACAAAGACGCGCCACACGACGCGGGACTATG
TTCCCCGCTGAGACCGAAAGGGAGTCAATGGCAAGCCGCATTTATTCAGCGCGGGACAAGCGCAACCAGTCTGCA
GTGGCAAGGGTACTGGGACATGATATGATGGAGGAGATCAAGCGATCAGCGGGCACCTCGACTAGAGGACCCCGC
GGGGAGGTCAACATTGAAGTGCTTCTTCGAGGCGCCGAGATCCTGTGCAATGTTTACCCCGTTGCCGGTGCACAG
GAAAAAATTGCCAACCTTCGCTATCGGCATGAGATGATCAGTGAGTCCATAGCGCAGTTAGAAGGCCGGGTTGCA
ACGAATACTGCAGAACTGGATCATATGAGACACTCTTATGGAGATGATGAAGATGATTTTCCCCCTGCACCGGTG
GCACAGCCAGAGATTCCAGAGGTCACTGATGAGGATATTGAACGGGAGTTGGCTGAAATCCGGGGCTTGGAGCAG
AGGAAGCGAAGGCTCGAAGAACGGGTTACAGGCATGGATCGAGATTTGGGTGGTTTGATAGGCTGA
Gene >Pro_DTO377G3_2|g6851.t1
ATGTCATTGCTCAATTCTCACCTAGAACAGATTAGACTCTCTTCCAATGCTATCGCCGATTTGCCGTTAGTGCCT
ATGATCTCCCTCAACCATGTTGCTTTGACTAACGCAAGCAAGCATTCAGGTTCCCTCCCCCACGTATTTTCACCA
CTGCACTGCTGGGCTCTCACGATATAACAGCATTGATTCGTGATACCGAAGCCCACGAACGAGCACTCTTCCAGG
TTGACCCGTCTACCAAAGCCCATGGACCACAAAGACGCGCCACACGACGCGGGACTATGTTCCCCGCTGAGACCG
AAAGGGAGTCAATGGCAAGCCGCATTTATTCAGCGCGGGACAAGCGCAACCAGTCTGCAGTGGCAAGGGTACTGG
GACATGATATGATGGAGGAGATCAAGCGATCAGCGGGCACCTCGACTAGAGGACCCCGCGGGGAGGTCAACATTG
AAGTGCTTCTTCGAGGCGCCGAGATCCTGTGCAATGTTTAGTGAGTGCTATATACCTGATAACAAGTATTGCTTG
ATCTAACCAGCTCAAAGCCCCGTTGCCGGTGCACAGGAAAAAATTGCCAACCTTCGCTATCGGCATGAGATGATC
AGTGAGTCCATAGCGCAGTTAGAAGGCCGGGTTGCAACGAATACTGCAGAACTGGATCATATGAGACACTCTTAT
GGAGATGATGAAGATGATTTTCCCCCTGCACCGGTGGCACAGCCAGAGATTCCAGAGGTCACTGATGAGGATATT
GAACGGGAGTTGGCTGAAATCCGGGGCTTGGAGCAGAGGAAGCGAAGGCTCGAAGAACGGGTTACAGGCATGGAT
CGAGATTTGGGTGGTTTGATAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail