Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6842.t1
Gene name
Locationscaffold_19:153982..157472
Strand-
Gene length (bp)3490
Transcript length (bp)3426
Coding sequence length (bp)3426
Protein length (aa) 1142

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain 1.4E-10 672 734
PF00179 UQ_con Ubiquitin-conjugating enzyme 1.0E-05 1026 1098

GO

GO Term Description Terminal node
GO:0003950 NAD+ ADP-ribosyltransferase activity Yes
GO:0016763 transferase activity, transferring pentosyl groups No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6842.t1
MPRKEFLRDLADAAVPGRFPCTSDIRTGEYDGSISFTFVAPEASLTLDLQAIVSDSHDYPRDHGFLVFPSSENCP
KTVSSSLENAVPSFTGLTIHELLRNIEKMITNSMVDPDSTSSYLEDLGSRDSDSDDSTAGDTEPGWESDDETRIF
TSTQSKTKLREKIRRDLRVVKNAGFKVGYLGLKHGDIIVSVSCRISKLGISEEAMDSWGVEPSEYLVLLIRYRPT
YHELQTIIEIAIDSKNPPVQMNVGLCSSYKPSLEHAMEVIQESQDQRTKDESMTSDKTIRGHLFRPLFIGKSLNL
LIRERLLGIISLRLKHGLSWTGAELFFQTNQGRDYSSENFSEEDYQPDSWATSTPEILLADHMTELDRNISNMSF
PLLAMQFTLRHFVKCTEFCLVCHCKTGDAFESLKPYVCSNDLCLYQYMALGLGASLEYEIQSQPFVVDLLTSLAY
ARASAGLLEDFPTGLRLRVPEKLLPKENSDCSTNYIGQFDATDLEIRLDQPTPVKVGDWIVLIMKTPKPAEWHCR
VEHIGETLNHIRISCPISRGRRVQPGEVLGVEPQQVRFVVYDTNLDDLAPTQKQWMISCLLAILPSIEEMKTFIE
SDKRGKLLSTWRDVISPAGLDLLRWVVASNRSFIKQDVDEPRHQIDGMGDYMQFRLVQGAVDKEQRFLQAVNSTS
LAQNPKHPTIFAWHGSALHNWHSILREGLHFKQVVHGRSCGHGVYMSNHFHTSLSYCGRNLLPTFSTSPALSASR
LELATVISLNEVVNAPNQFVCRSPYVVQHLDWIQPRYLFVKLCDLNVPGMAKKTDGYAHGSKSKSSKAQPSSYQH
DESLLYKQDKRYPAVGPSNKQIKIPISVFSGQRANFLHAASETGLADLVPSPKRRKYSIQDTEQHNDDNDDNVSV
ETTTEDLSILLSDDEMCESPPGPSMQEGAVPATDLKTDFRPGTLEDTSLPTLSPPQFATTSATKILQQHLQATIK
TQERVPLHELGWYVDPSLITTVYQWIAELHTFDPSLPLAKDLKKTKQKSIVLELRFPRQFPMDPPLVRVIRPRFL
QFAAGGGGHVTAGGSMCMELLTHSGWLPTTSIESLLLQVRMAITSTDPRPARLDIHSAKIDYSVGEAVDAYRRVA
LAHGWQISKDIQQLAW*
Coding >Pro_DTO377G3_2|g6842.t1
ATGCCACGCAAAGAATTCCTGCGAGATCTCGCAGATGCAGCGGTCCCTGGCCGATTCCCCTGTACCTCCGATATC
AGAACAGGGGAGTATGATGGATCAATTTCCTTCACATTTGTAGCACCCGAGGCAAGCCTCACCCTTGATCTCCAA
GCTATAGTTTCCGACTCTCACGATTATCCCAGGGACCATGGCTTTTTGGTCTTCCCATCGTCCGAGAACTGTCCA
AAGACAGTCAGCTCCTCCCTCGAAAATGCAGTGCCTTCATTCACAGGCTTAACTATCCATGAATTGTTGCGCAAC
ATTGAGAAAATGATCACCAACTCTATGGTTGATCCTGATTCGACATCCAGTTACCTAGAGGACCTAGGCTCTCGT
GACTCCGACTCCGACGACTCGACTGCCGGTGATACTGAGCCAGGCTGGGAGTCTGATGATGAAACCAGAATATTC
ACATCTACTCAAAGTAAGACGAAGTTACGAGAGAAGATTCGCCGTGACCTTCGTGTGGTCAAGAACGCGGGATTC
AAAGTGGGATACCTGGGGTTAAAACATGGCGATATTATTGTGTCAGTGTCTTGCCGCATTTCCAAGCTTGGCATT
TCCGAGGAAGCTATGGATTCTTGGGGCGTCGAACCGTCGGAGTATTTGGTTTTGCTGATCCGTTATCGACCGACT
TACCATGAACTCCAAACAATTATCGAGATAGCAATTGATTCGAAAAACCCACCGGTTCAGATGAATGTTGGCCTT
TGCAGCTCATACAAGCCATCCTTAGAGCACGCTATGGAAGTTATACAGGAGTCACAGGATCAACGGACGAAAGAC
GAGAGTATGACTTCGGACAAAACAATACGTGGTCATCTTTTCAGGCCGCTGTTCATTGGAAAATCGCTCAATTTA
CTTATCAGAGAGCGCCTGCTTGGGATCATCAGTCTTCGACTAAAACATGGGCTTTCATGGACAGGGGCAGAACTT
TTCTTCCAGACCAACCAAGGCAGGGATTACAGCTCTGAGAACTTTTCCGAGGAGGACTATCAGCCGGACAGCTGG
GCCACGTCGACGCCAGAAATCCTTTTGGCTGATCATATGACCGAACTGGACCGCAATATCTCTAATATGTCTTTT
CCTCTTCTTGCCATGCAGTTTACCCTGCGGCATTTTGTCAAGTGCACAGAATTTTGCTTAGTTTGCCACTGCAAA
ACTGGTGATGCCTTCGAATCACTGAAGCCATATGTTTGCTCCAATGATTTATGCCTCTACCAATACATGGCGCTG
GGACTGGGTGCAAGCCTTGAGTATGAGATCCAGTCCCAGCCCTTTGTCGTTGACTTGCTAACCAGCCTGGCATAC
GCGAGGGCTTCAGCGGGGCTTCTTGAAGACTTCCCAACTGGTCTTCGGCTACGCGTACCCGAGAAATTACTTCCT
AAAGAAAACTCAGATTGTTCTACAAATTATATCGGGCAATTTGATGCAACCGATCTTGAAATTCGGCTAGATCAG
CCGACTCCGGTCAAAGTCGGCGATTGGATTGTCCTCATTATGAAGACTCCAAAACCTGCAGAATGGCACTGTCGT
GTTGAACACATTGGCGAGACGTTAAATCATATTCGCATCTCATGTCCAATTAGTAGAGGCCGTCGAGTGCAGCCA
GGAGAGGTGCTAGGGGTGGAGCCCCAGCAAGTGAGATTTGTTGTTTATGACACCAATCTAGACGATTTGGCACCC
ACACAGAAACAGTGGATGATTTCTTGCCTATTGGCCATACTACCTAGTATCGAGGAAATGAAGACATTCATTGAG
AGTGACAAAAGGGGCAAGCTTCTTTCAACCTGGAGAGACGTCATATCCCCTGCTGGATTGGACCTTTTACGCTGG
GTTGTCGCCTCAAATCGATCTTTCATCAAGCAAGATGTCGATGAGCCTCGGCATCAGATAGATGGAATGGGCGAC
TACATGCAATTCAGACTTGTTCAAGGTGCTGTCGACAAAGAGCAGCGCTTTCTTCAAGCGGTCAACTCCACTTCT
TTGGCCCAGAATCCAAAGCATCCTACTATATTCGCTTGGCATGGCAGCGCTTTGCATAATTGGCACAGTATTCTA
CGTGAGGGGTTGCATTTCAAGCAAGTTGTCCATGGCCGCTCCTGTGGTCATGGTGTTTACATGTCGAACCACTTC
CATACCTCATTGTCATACTGTGGTAGGAATCTTCTTCCCACGTTTTCCACATCTCCCGCGTTGTCCGCGAGTCGG
CTGGAGCTCGCGACGGTGATTTCTCTTAATGAGGTCGTCAATGCTCCCAATCAGTTTGTGTGCCGTAGTCCCTAC
GTCGTGCAACACTTGGATTGGATCCAACCAAGGTACCTTTTCGTCAAGCTCTGTGACTTGAACGTACCTGGTATG
GCAAAGAAAACTGATGGATATGCGCATGGGAGTAAGTCAAAGAGCTCAAAAGCCCAGCCATCATCGTATCAACAT
GATGAAAGCCTTTTATACAAACAAGATAAACGTTATCCGGCTGTCGGTCCCAGCAACAAACAGATCAAAATTCCC
ATCTCCGTATTTAGCGGCCAAAGGGCAAACTTCCTTCATGCCGCTAGTGAAACCGGGCTTGCAGACCTTGTGCCG
TCACCCAAGAGACGCAAATATTCAATTCAAGATACTGAACAACACAACGACGACAACGACGACAATGTCAGCGTT
GAAACGACCACAGAGGATCTCAGCATTCTTTTATCTGACGATGAGATGTGTGAAAGTCCCCCAGGTCCTAGCATG
CAAGAAGGAGCTGTCCCAGCAACAGACCTCAAGACTGATTTCCGACCCGGAACCCTAGAGGATACTTCTTTGCCT
ACACTCTCTCCACCCCAATTTGCGACTACCTCAGCCACAAAAATCCTACAGCAGCATCTTCAGGCTACCATAAAA
ACCCAGGAGCGAGTGCCACTCCATGAGCTCGGATGGTACGTCGACCCCAGCTTGATTACAACAGTCTACCAATGG
ATTGCAGAGCTGCATACGTTTGATCCATCCCTCCCACTAGCAAAAGACCTCAAAAAGACCAAACAAAAAAGCATC
GTCTTGGAGCTCCGCTTTCCCCGGCAATTCCCTATGGATCCACCCCTTGTACGGGTCATTCGCCCTCGTTTCCTC
CAGTTCGCCGCTGGAGGCGGCGGCCACGTTACCGCCGGTGGATCTATGTGCATGGAACTGCTGACACACTCGGGC
TGGCTACCAACGACTTCAATTGAGAGTTTGTTGTTGCAGGTTCGCATGGCTATTACCAGCACCGACCCAAGACCC
GCGCGTCTGGATATCCATAGCGCAAAAATCGACTATTCAGTAGGCGAAGCAGTAGACGCCTACAGAAGAGTTGCA
TTGGCGCATGGATGGCAGATCTCGAAGGATATTCAGCAACTTGCCTGGTAG
Transcript >Pro_DTO377G3_2|g6842.t1
ATGCCACGCAAAGAATTCCTGCGAGATCTCGCAGATGCAGCGGTCCCTGGCCGATTCCCCTGTACCTCCGATATC
AGAACAGGGGAGTATGATGGATCAATTTCCTTCACATTTGTAGCACCCGAGGCAAGCCTCACCCTTGATCTCCAA
GCTATAGTTTCCGACTCTCACGATTATCCCAGGGACCATGGCTTTTTGGTCTTCCCATCGTCCGAGAACTGTCCA
AAGACAGTCAGCTCCTCCCTCGAAAATGCAGTGCCTTCATTCACAGGCTTAACTATCCATGAATTGTTGCGCAAC
ATTGAGAAAATGATCACCAACTCTATGGTTGATCCTGATTCGACATCCAGTTACCTAGAGGACCTAGGCTCTCGT
GACTCCGACTCCGACGACTCGACTGCCGGTGATACTGAGCCAGGCTGGGAGTCTGATGATGAAACCAGAATATTC
ACATCTACTCAAAGTAAGACGAAGTTACGAGAGAAGATTCGCCGTGACCTTCGTGTGGTCAAGAACGCGGGATTC
AAAGTGGGATACCTGGGGTTAAAACATGGCGATATTATTGTGTCAGTGTCTTGCCGCATTTCCAAGCTTGGCATT
TCCGAGGAAGCTATGGATTCTTGGGGCGTCGAACCGTCGGAGTATTTGGTTTTGCTGATCCGTTATCGACCGACT
TACCATGAACTCCAAACAATTATCGAGATAGCAATTGATTCGAAAAACCCACCGGTTCAGATGAATGTTGGCCTT
TGCAGCTCATACAAGCCATCCTTAGAGCACGCTATGGAAGTTATACAGGAGTCACAGGATCAACGGACGAAAGAC
GAGAGTATGACTTCGGACAAAACAATACGTGGTCATCTTTTCAGGCCGCTGTTCATTGGAAAATCGCTCAATTTA
CTTATCAGAGAGCGCCTGCTTGGGATCATCAGTCTTCGACTAAAACATGGGCTTTCATGGACAGGGGCAGAACTT
TTCTTCCAGACCAACCAAGGCAGGGATTACAGCTCTGAGAACTTTTCCGAGGAGGACTATCAGCCGGACAGCTGG
GCCACGTCGACGCCAGAAATCCTTTTGGCTGATCATATGACCGAACTGGACCGCAATATCTCTAATATGTCTTTT
CCTCTTCTTGCCATGCAGTTTACCCTGCGGCATTTTGTCAAGTGCACAGAATTTTGCTTAGTTTGCCACTGCAAA
ACTGGTGATGCCTTCGAATCACTGAAGCCATATGTTTGCTCCAATGATTTATGCCTCTACCAATACATGGCGCTG
GGACTGGGTGCAAGCCTTGAGTATGAGATCCAGTCCCAGCCCTTTGTCGTTGACTTGCTAACCAGCCTGGCATAC
GCGAGGGCTTCAGCGGGGCTTCTTGAAGACTTCCCAACTGGTCTTCGGCTACGCGTACCCGAGAAATTACTTCCT
AAAGAAAACTCAGATTGTTCTACAAATTATATCGGGCAATTTGATGCAACCGATCTTGAAATTCGGCTAGATCAG
CCGACTCCGGTCAAAGTCGGCGATTGGATTGTCCTCATTATGAAGACTCCAAAACCTGCAGAATGGCACTGTCGT
GTTGAACACATTGGCGAGACGTTAAATCATATTCGCATCTCATGTCCAATTAGTAGAGGCCGTCGAGTGCAGCCA
GGAGAGGTGCTAGGGGTGGAGCCCCAGCAAGTGAGATTTGTTGTTTATGACACCAATCTAGACGATTTGGCACCC
ACACAGAAACAGTGGATGATTTCTTGCCTATTGGCCATACTACCTAGTATCGAGGAAATGAAGACATTCATTGAG
AGTGACAAAAGGGGCAAGCTTCTTTCAACCTGGAGAGACGTCATATCCCCTGCTGGATTGGACCTTTTACGCTGG
GTTGTCGCCTCAAATCGATCTTTCATCAAGCAAGATGTCGATGAGCCTCGGCATCAGATAGATGGAATGGGCGAC
TACATGCAATTCAGACTTGTTCAAGGTGCTGTCGACAAAGAGCAGCGCTTTCTTCAAGCGGTCAACTCCACTTCT
TTGGCCCAGAATCCAAAGCATCCTACTATATTCGCTTGGCATGGCAGCGCTTTGCATAATTGGCACAGTATTCTA
CGTGAGGGGTTGCATTTCAAGCAAGTTGTCCATGGCCGCTCCTGTGGTCATGGTGTTTACATGTCGAACCACTTC
CATACCTCATTGTCATACTGTGGTAGGAATCTTCTTCCCACGTTTTCCACATCTCCCGCGTTGTCCGCGAGTCGG
CTGGAGCTCGCGACGGTGATTTCTCTTAATGAGGTCGTCAATGCTCCCAATCAGTTTGTGTGCCGTAGTCCCTAC
GTCGTGCAACACTTGGATTGGATCCAACCAAGGTACCTTTTCGTCAAGCTCTGTGACTTGAACGTACCTGGTATG
GCAAAGAAAACTGATGGATATGCGCATGGGAGTAAGTCAAAGAGCTCAAAAGCCCAGCCATCATCGTATCAACAT
GATGAAAGCCTTTTATACAAACAAGATAAACGTTATCCGGCTGTCGGTCCCAGCAACAAACAGATCAAAATTCCC
ATCTCCGTATTTAGCGGCCAAAGGGCAAACTTCCTTCATGCCGCTAGTGAAACCGGGCTTGCAGACCTTGTGCCG
TCACCCAAGAGACGCAAATATTCAATTCAAGATACTGAACAACACAACGACGACAACGACGACAATGTCAGCGTT
GAAACGACCACAGAGGATCTCAGCATTCTTTTATCTGACGATGAGATGTGTGAAAGTCCCCCAGGTCCTAGCATG
CAAGAAGGAGCTGTCCCAGCAACAGACCTCAAGACTGATTTCCGACCCGGAACCCTAGAGGATACTTCTTTGCCT
ACACTCTCTCCACCCCAATTTGCGACTACCTCAGCCACAAAAATCCTACAGCAGCATCTTCAGGCTACCATAAAA
ACCCAGGAGCGAGTGCCACTCCATGAGCTCGGATGGTACGTCGACCCCAGCTTGATTACAACAGTCTACCAATGG
ATTGCAGAGCTGCATACGTTTGATCCATCCCTCCCACTAGCAAAAGACCTCAAAAAGACCAAACAAAAAAGCATC
GTCTTGGAGCTCCGCTTTCCCCGGCAATTCCCTATGGATCCACCCCTTGTACGGGTCATTCGCCCTCGTTTCCTC
CAGTTCGCCGCTGGAGGCGGCGGCCACGTTACCGCCGGTGGATCTATGTGCATGGAACTGCTGACACACTCGGGC
TGGCTACCAACGACTTCAATTGAGAGTTTGTTGTTGCAGGTTCGCATGGCTATTACCAGCACCGACCCAAGACCC
GCGCGTCTGGATATCCATAGCGCAAAAATCGACTATTCAGTAGGCGAAGCAGTAGACGCCTACAGAAGAGTTGCA
TTGGCGCATGGATGGCAGATCTCGAAGGATATTCAGCAACTTGCCTGGTAG
Gene >Pro_DTO377G3_2|g6842.t1
ATGCCACGCAAAGAATTCCTGCGAGATCTCGCAGATGCAGCGGTCCCTGGCCGATTCCCCTGTACCTCCGATATC
AGAACAGGGGAGTATGATGGATCAATTTCCTTCACATTTGTAGCACCCGAGGCAAGCCTCACCCTTGATCTCCAA
GCTATAGTTTCCGGTAATTAATATTACTAGCTCATAGTATCTTTCAAGGATCTAATCTCTTGCTGACGCACAAGC
AGACTCTCACGATTATCCCAGGGACCATGGCTTTTTGGTCTTCCCATCGTCCGAGAACTGTCCAAAGACAGTCAG
CTCCTCCCTCGAAAATGCAGTGCCTTCATTCACAGGCTTAACTATCCATGAATTGTTGCGCAACATTGAGAAAAT
GATCACCAACTCTATGGTTGATCCTGATTCGACATCCAGTTACCTAGAGGACCTAGGCTCTCGTGACTCCGACTC
CGACGACTCGACTGCCGGTGATACTGAGCCAGGCTGGGAGTCTGATGATGAAACCAGAATATTCACATCTACTCA
AAGTAAGACGAAGTTACGAGAGAAGATTCGCCGTGACCTTCGTGTGGTCAAGAACGCGGGATTCAAAGTGGGATA
CCTGGGGTTAAAACATGGCGATATTATTGTGTCAGTGTCTTGCCGCATTTCCAAGCTTGGCATTTCCGAGGAAGC
TATGGATTCTTGGGGCGTCGAACCGTCGGAGTATTTGGTTTTGCTGATCCGTTATCGACCGACTTACCATGAACT
CCAAACAATTATCGAGATAGCAATTGATTCGAAAAACCCACCGGTTCAGATGAATGTTGGCCTTTGCAGCTCATA
CAAGCCATCCTTAGAGCACGCTATGGAAGTTATACAGGAGTCACAGGATCAACGGACGAAAGACGAGAGTATGAC
TTCGGACAAAACAATACGTGGTCATCTTTTCAGGCCGCTGTTCATTGGAAAATCGCTCAATTTACTTATCAGAGA
GCGCCTGCTTGGGATCATCAGTCTTCGACTAAAACATGGGCTTTCATGGACAGGGGCAGAACTTTTCTTCCAGAC
CAACCAAGGCAGGGATTACAGCTCTGAGAACTTTTCCGAGGAGGACTATCAGCCGGACAGCTGGGCCACGTCGAC
GCCAGAAATCCTTTTGGCTGATCATATGACCGAACTGGACCGCAATATCTCTAATATGTCTTTTCCTCTTCTTGC
CATGCAGTTTACCCTGCGGCATTTTGTCAAGTGCACAGAATTTTGCTTAGTTTGCCACTGCAAAACTGGTGATGC
CTTCGAATCACTGAAGCCATATGTTTGCTCCAATGATTTATGCCTCTACCAATACATGGCGCTGGGACTGGGTGC
AAGCCTTGAGTATGAGATCCAGTCCCAGCCCTTTGTCGTTGACTTGCTAACCAGCCTGGCATACGCGAGGGCTTC
AGCGGGGCTTCTTGAAGACTTCCCAACTGGTCTTCGGCTACGCGTACCCGAGAAATTACTTCCTAAAGAAAACTC
AGATTGTTCTACAAATTATATCGGGCAATTTGATGCAACCGATCTTGAAATTCGGCTAGATCAGCCGACTCCGGT
CAAAGTCGGCGATTGGATTGTCCTCATTATGAAGACTCCAAAACCTGCAGAATGGCACTGTCGTGTTGAACACAT
TGGCGAGACGTTAAATCATATTCGCATCTCATGTCCAATTAGTAGAGGCCGTCGAGTGCAGCCAGGAGAGGTGCT
AGGGGTGGAGCCCCAGCAAGTGAGATTTGTTGTTTATGACACCAATCTAGACGATTTGGCACCCACACAGAAACA
GTGGATGATTTCTTGCCTATTGGCCATACTACCTAGTATCGAGGAAATGAAGACATTCATTGAGAGTGACAAAAG
GGGCAAGCTTCTTTCAACCTGGAGAGACGTCATATCCCCTGCTGGATTGGACCTTTTACGCTGGGTTGTCGCCTC
AAATCGATCTTTCATCAAGCAAGATGTCGATGAGCCTCGGCATCAGATAGATGGAATGGGCGACTACATGCAATT
CAGACTTGTTCAAGGTGCTGTCGACAAAGAGCAGCGCTTTCTTCAAGCGGTCAACTCCACTTCTTTGGCCCAGAA
TCCAAAGCATCCTACTATATTCGCTTGGCATGGCAGCGCTTTGCATAATTGGCACAGTATTCTACGTGAGGGGTT
GCATTTCAAGCAAGTTGTCCATGGCCGCTCCTGTGGTCATGGTGTTTACATGTCGAACCACTTCCATACCTCATT
GTCATACTGTGGTAGGAATCTTCTTCCCACGTTTTCCACATCTCCCGCGTTGTCCGCGAGTCGGCTGGAGCTCGC
GACGGTGATTTCTCTTAATGAGGTCGTCAATGCTCCCAATCAGTTTGTGTGCCGTAGTCCCTACGTCGTGCAACA
CTTGGATTGGATCCAACCAAGGTACCTTTTCGTCAAGCTCTGTGACTTGAACGTACCTGGTATGGCAAAGAAAAC
TGATGGATATGCGCATGGGAGTAAGTCAAAGAGCTCAAAAGCCCAGCCATCATCGTATCAACATGATGAAAGCCT
TTTATACAAACAAGATAAACGTTATCCGGCTGTCGGTCCCAGCAACAAACAGATCAAAATTCCCATCTCCGTATT
TAGCGGCCAAAGGGCAAACTTCCTTCATGCCGCTAGTGAAACCGGGCTTGCAGACCTTGTGCCGTCACCCAAGAG
ACGCAAATATTCAATTCAAGATACTGAACAACACAACGACGACAACGACGACAATGTCAGCGTTGAAACGACCAC
AGAGGATCTCAGCATTCTTTTATCTGACGATGAGATGTGTGAAAGTCCCCCAGGTCCTAGCATGCAAGAAGGAGC
TGTCCCAGCAACAGACCTCAAGACTGATTTCCGACCCGGAACCCTAGAGGATACTTCTTTGCCTACACTCTCTCC
ACCCCAATTTGCGACTACCTCAGCCACAAAAATCCTACAGCAGCATCTTCAGGCTACCATAAAAACCCAGGAGCG
AGTGCCACTCCATGAGCTCGGATGGTACGTCGACCCCAGCTTGATTACAACAGTCTACCAATGGATTGCAGAGCT
GCATACGTTTGATCCATCCCTCCCACTAGCAAAAGACCTCAAAAAGACCAAACAAAAAAGCATCGTCTTGGAGCT
CCGCTTTCCCCGGCAATTCCCTATGGATCCACCCCTTGTACGGGTCATTCGCCCTCGTTTCCTCCAGTTCGCCGC
TGGAGGCGGCGGCCACGTTACCGCCGGTGGATCTATGTGCATGGAACTGCTGACACACTCGGGCTGGCTACCAAC
GACTTCAATTGAGAGTTTGTTGTTGCAGGTTCGCATGGCTATTACCAGCACCGACCCAAGACCCGCGCGTCTGGA
TATCCATAGCGCAAAAATCGACTATTCAGTAGGCGAAGCAGTAGACGCCTACAGAAGAGTTGCATTGGCGCATGG
ATGGCAGATCTCGAAGGATATTCAGCAACTTGCCTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail