Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6834.t1
Gene name
Locationscaffold_19:134511..135320
Strand-
Gene length (bp)809
Transcript length (bp)438
Coding sequence length (bp)438
Protein length (aa) 146

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 46 65 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1506.63 905.40 2107.85
5d_25C Five days - 25 degrees Celsius 1558.52 930.34 2186.69
7d_25C Seven days - 25 degrees Celsius 1489.97 889.18 2090.76
10d_25C Ten days - 25 degrees Celsius 1921.99 1117.52 2726.46
7d_15C Seven days - 15 degrees Celsius 2170.05 1255.56 3084.55
7d_30C Seven days - 30 degrees Celsius 864.93 526.89 1202.97

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.923592 no
3d_25C 7d_25C 0.975139 no
3d_25C 7d_15C 0.111180 no
3d_25C 7d_30C 0.008469 yes
3d_25C 10d_25C 0.335467 no
5d_25C 7d_25C 0.891859 no
5d_25C 7d_15C 0.161481 no
5d_25C 7d_30C 0.003625 yes
5d_25C 10d_25C 0.418753 no
7d_25C 7d_15C 0.101730 no
7d_25C 7d_30C 0.009446 yes
7d_25C 10d_25C 0.310007 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.692420 no
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6834.t1
MSSIAALATRRALTRQSLLRAPPRRFSSAKVEEGNLEKAGKRDPELYVLLGVMSGAFLIAGWYFGRKPTSVTSES
NVRIGESAMPWQGQSEDGKVYKYQYHPHGDKNQPLRAAPSAMNTVIVPNVTLPEDLHERFNKYGKEEWDY*
Coding >Pro_DTO377G3_2|g6834.t1
ATGTCCTCAATTGCTGCTCTGGCTACCCGCCGGGCTCTGACCCGCCAGTCCCTCCTCCGCGCTCCCCCGCGCCGC
TTCAGCTCCGCCAAGGTCGAGGAGGGCAACCTCGAAAAGGCCGGCAAGCGTGATCCCGAGCTCTACGTCCTTCTC
GGTGTCATGTCTGGTGCTTTCCTGATTGCCGGATGGTACTTCGGCCGCAAGCCCACCTCCGTGACCTCTGAGAGC
AACGTTCGCATTGGCGAGAGTGCCATGCCCTGGCAGGGCCAGTCCGAGGATGGCAAGGTCTACAAGTACCAGTAC
CACCCCCACGGCGACAAGAACCAGCCCCTCCGTGCTGCCCCCAGCGCCATGAACACTGTCATTGTTCCCAATGTC
ACCCTGCCCGAGGACCTCCACGAGCGGTTCAACAAGTACGGCAAGGAGGAGTGGGACTACTAA
Transcript >Pro_DTO377G3_2|g6834.t1
ATGTCCTCAATTGCTGCTCTGGCTACCCGCCGGGCTCTGACCCGCCAGTCCCTCCTCCGCGCTCCCCCGCGCCGC
TTCAGCTCCGCCAAGGTCGAGGAGGGCAACCTCGAAAAGGCCGGCAAGCGTGATCCCGAGCTCTACGTCCTTCTC
GGTGTCATGTCTGGTGCTTTCCTGATTGCCGGATGGTACTTCGGCCGCAAGCCCACCTCCGTGACCTCTGAGAGC
AACGTTCGCATTGGCGAGAGTGCCATGCCCTGGCAGGGCCAGTCCGAGGATGGCAAGGTCTACAAGTACCAGTAC
CACCCCCACGGCGACAAGAACCAGCCCCTCCGTGCTGCCCCCAGCGCCATGAACACTGTCATTGTTCCCAATGTC
ACCCTGCCCGAGGACCTCCACGAGCGGTTCAACAAGTACGGCAAGGAGGAGTGGGACTACTAA
Gene >Pro_DTO377G3_2|g6834.t1
ATGTCCTCAATTGCTGCTCTGGCTACCCGCCGGGCTCTGACCCGCCAGTCCCTCCTCCGCGCTCCCCCGCGCCGC
TTCAGCTCCGCCAAGGTCGAGGAGGGCAACCTCGAAAAGGCCGGCAAGCGTGATCCCGAGCTCTACGTACGGATC
CCACGGAGCCATTGAACCATGCTCGATCTTTCGTCCTAACTGCTGTACTTCTAGGTCCTTCTCGGTGTCATGTCT
GGTGCTTTCCTGATTGCCGGATGGTGAGCATCCCTCCCGAAATTGCCCTACAATGCCTCGTCCCTGGGTCGCCCC
ATTTCCGCCACTGTGACGTCGGCACCTCTTTTGGGGTTTACCTCACCTACCTATCACTCTCAATGGCGCATACAC
ATACAATAATCACCACGGTCGCTAATCAGTTCGGTATTTGCGATAATATAGGTACTTCGGCCGCAAGCCCACCTC
CGTGACCTCTGAGAGCAACGTTCGCATTGGCGAGAGTGCCATGCCCTGGCAGGGCCAGTCCGAGGATGGCAAGGT
CTACAAGTACCAGTACCACCCCCACGGCGACAAGAACCAGCCCCTCCGTGCTGCCCCCAGCGCCATGAACACTGT
CATTGTTCCCAATGTCACCCTGCCCGAGGTATGAATTCGCTGATACTTCTTATTTATGCCATACGTTGGTTGGAT
CACTTCAGAACTTGTTGAAAGTGTCATGTGTGATCGCGTTGCTGTTTTGGTAGTAAATGCTGACATTAGCTTCTT
TCTAATAGGACCTCCACGAGCGGTTCAACAAGTACGGCAAGGAGGAGTGGGACTACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail