Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6831.t1
Gene name
Locationscaffold_19:125596..127783
Strand+
Gene length (bp)2187
Transcript length (bp)2076
Coding sequence length (bp)2076
Protein length (aa) 692

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06428 Sec2p GDP/GTP exchange factor Sec2p 1.4E-28 172 260

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 67.58 41.42 93.74
5d_25C Five days - 25 degrees Celsius 65.34 40.07 90.61
7d_25C Seven days - 25 degrees Celsius 70.54 43.05 98.03
10d_25C Ten days - 25 degrees Celsius 73.70 45.17 102.24
7d_15C Seven days - 15 degrees Celsius 87.14 52.35 121.94
7d_30C Seven days - 30 degrees Celsius 48.68 29.20 68.17

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.916929 no
3d_25C 7d_25C 0.895855 no
3d_25C 7d_15C 0.272962 no
3d_25C 7d_30C 0.140277 no
3d_25C 10d_25C 0.761176 no
5d_25C 7d_25C 0.797585 no
5d_25C 7d_15C 0.201363 no
5d_25C 7d_30C 0.192160 no
5d_25C 10d_25C 0.649520 no
7d_25C 7d_15C 0.394621 no
7d_25C 7d_30C 0.090497 no
7d_25C 10d_25C 0.893005 no
7d_15C 7d_30C 0.003625 yes
7d_15C 10d_25C 0.512388 no
7d_30C 10d_25C 0.049382 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6831.t1
MADLIAFQTSHHSFFSPSKMISRNSHKRSLSSEHRSLSPDRTVTKAKSTTNLSEIAAANAAQNSGYYESSFSTLQ
DPRLLIGSEVSHSTSSSHHPDLSNEVAALSVKLIQAINNQTNLDDNLVATRQELELAQGKIQALEYQNEKYRRDI
DNQVYIKKVDSDREISQLRDALAEETTLRLAAEKGRKNIEQEVETLTAALFEEANKMVASAKIDREAVEKKNEQL
RSQVKDTELLLASHQDQLAELKSVMQTMNLHKDDMEGRPANSPSSPDESQAQGSNQDTEFEPVPILIGNPEEFTP
GPSSSFPHLLRMVCRADLQAYEDFRDLLVLSRSSKPPSRAASGSYGGLNVMGLASFASGGSPSSTSSPTKGFSYS
PNGSISSTTGSGFSLKETRFYKRVLMEDIEPTLRLDLAPGISWLTRRTVLSGICEGSLVVEPMPTSAQKFEFPCS
VCGERRPGTSNARTHRFRTSDSETAQRYSLCILCLERVRSCCEFTGYLRLILDGHLRAGDTEEEKEIWDETIRLR
ERMFWSRVGGGIIPLGNRPSEPEVPASTEPNTGVQDDADQYLYPVDVTYLEPRTEKVPVADQIAPETPVRASTTD
HITPPDLSRPQSPMYDRDDAASLDDLQRKRLSIDSAASVYEEASTDVDANTTAPAPNEPSIIQSRETDTDIAKPN
GLSDSLPRLITSDQHE*
Coding >Pro_DTO377G3_2|g6831.t1
ATGGCCGATTTAATTGCCTTTCAGACCTCGCATCATAGCTTCTTCTCCCCATCCAAAATGATCTCGCGCAACTCC
CATAAGAGGTCGCTCTCCTCCGAGCACCGGTCCTTATCTCCTGACCGAACCGTCACGAAAGCCAAGTCCACCACC
AATCTCTCCGAGATCGCCGCTGCCAATGCAGCACAAAACTCCGGATATTACGAAAGCAGTTTTAGCACATTGCAA
GACCCGCGATTGCTGATCGGGTCGGAGGTCTCGCATTCGACGTCATCGTCTCACCACCCGGATCTGAGCAACGAA
GTAGCGGCATTGTCTGTGAAATTGATCCAGGCTATCAACAACCAAACAAACCTTGACGATAATCTGGTCGCTACT
CGGCAAGAGCTAGAGCTGGCTCAGGGCAAAATTCAAGCTCTGGAGTACCAGAACGAGAAATATCGGCGAGATATT
GATAACCAAGTCTATATAAAGAAGGTCGACTCTGATCGCGAAATTTCGCAATTACGAGATGCATTAGCAGAAGAA
ACGACCTTGCGTCTCGCCGCTGAAAAGGGCAGGAAAAATATTGAGCAAGAAGTGGAAACTCTCACTGCGGCTCTT
TTTGAAGAAGCCAATAAGATGGTAGCTTCGGCTAAAATTGACCGAGAGGCGGTGGAAAAGAAGAATGAGCAGTTG
CGTTCACAAGTCAAAGATACCGAGTTGCTCCTGGCATCGCACCAAGACCAGCTTGCCGAGCTCAAGTCTGTCATG
CAAACGATGAATCTTCACAAAGATGACATGGAAGGACGTCCCGCTAACAGTCCATCGTCTCCGGACGAGTCACAA
GCGCAAGGTTCTAACCAAGACACTGAGTTTGAACCCGTTCCTATATTGATTGGCAACCCGGAGGAGTTTACCCCG
GGTCCTTCCTCTAGCTTCCCTCATCTCCTCCGCATGGTATGTCGCGCGGATTTGCAGGCTTATGAGGATTTCCGC
GATTTGCTGGTACTCTCTCGGAGCTCAAAACCTCCCAGTCGTGCTGCTAGTGGGTCATATGGAGGCCTCAACGTG
ATGGGCCTGGCAAGCTTTGCGAGTGGAGGGTCTCCATCGTCGACCTCATCACCTACCAAAGGGTTTAGCTACTCC
CCTAATGGGAGCATATCTTCCACAACGGGTTCGGGATTTTCCTTGAAGGAAACTCGCTTCTACAAGCGGGTGCTT
ATGGAGGATATCGAACCTACATTGCGACTAGATCTAGCGCCGGGGATTTCTTGGTTGACGCGGCGTACCGTTCTA
AGTGGTATCTGCGAAGGCAGTCTCGTCGTCGAGCCAATGCCCACATCAGCTCAGAAATTCGAGTTCCCCTGCTCT
GTCTGTGGTGAACGCAGACCCGGCACGTCTAATGCGAGAACCCATCGTTTCCGAACGTCAGACAGCGAGACTGCT
CAAAGGTACTCACTTTGCATTCTCTGCTTAGAAAGAGTGCGCTCATGTTGCGAGTTCACTGGCTACTTGCGTCTC
ATCCTTGATGGACATCTTCGGGCTGGGGATACCGAAGAAGAAAAGGAAATCTGGGATGAGACTATCCGTCTCAGA
GAGAGGATGTTCTGGTCCCGCGTCGGAGGAGGCATCATTCCATTGGGCAATCGCCCAAGCGAACCGGAGGTGCCG
GCCAGCACAGAGCCTAATACTGGCGTCCAAGACGATGCCGACCAGTATCTCTATCCTGTGGACGTTACTTATCTC
GAGCCCAGGACAGAAAAAGTACCCGTTGCTGATCAAATCGCGCCGGAAACACCAGTTAGAGCATCCACTACTGAT
CATATAACCCCCCCTGATCTTTCTCGACCTCAAAGCCCTATGTATGACAGGGATGATGCTGCTTCTTTGGATGAC
TTGCAACGCAAGCGACTTTCTATTGATTCAGCAGCAAGCGTTTATGAAGAAGCCAGCACTGACGTGGATGCCAAT
ACCACGGCACCTGCCCCCAACGAACCCTCGATTATTCAGAGTCGAGAGACAGACACAGACATCGCCAAACCCAAT
GGTTTGAGCGACTCTTTACCTCGGTTGATCACAAGCGATCAACACGAGTGA
Transcript >Pro_DTO377G3_2|g6831.t1
ATGGCCGATTTAATTGCCTTTCAGACCTCGCATCATAGCTTCTTCTCCCCATCCAAAATGATCTCGCGCAACTCC
CATAAGAGGTCGCTCTCCTCCGAGCACCGGTCCTTATCTCCTGACCGAACCGTCACGAAAGCCAAGTCCACCACC
AATCTCTCCGAGATCGCCGCTGCCAATGCAGCACAAAACTCCGGATATTACGAAAGCAGTTTTAGCACATTGCAA
GACCCGCGATTGCTGATCGGGTCGGAGGTCTCGCATTCGACGTCATCGTCTCACCACCCGGATCTGAGCAACGAA
GTAGCGGCATTGTCTGTGAAATTGATCCAGGCTATCAACAACCAAACAAACCTTGACGATAATCTGGTCGCTACT
CGGCAAGAGCTAGAGCTGGCTCAGGGCAAAATTCAAGCTCTGGAGTACCAGAACGAGAAATATCGGCGAGATATT
GATAACCAAGTCTATATAAAGAAGGTCGACTCTGATCGCGAAATTTCGCAATTACGAGATGCATTAGCAGAAGAA
ACGACCTTGCGTCTCGCCGCTGAAAAGGGCAGGAAAAATATTGAGCAAGAAGTGGAAACTCTCACTGCGGCTCTT
TTTGAAGAAGCCAATAAGATGGTAGCTTCGGCTAAAATTGACCGAGAGGCGGTGGAAAAGAAGAATGAGCAGTTG
CGTTCACAAGTCAAAGATACCGAGTTGCTCCTGGCATCGCACCAAGACCAGCTTGCCGAGCTCAAGTCTGTCATG
CAAACGATGAATCTTCACAAAGATGACATGGAAGGACGTCCCGCTAACAGTCCATCGTCTCCGGACGAGTCACAA
GCGCAAGGTTCTAACCAAGACACTGAGTTTGAACCCGTTCCTATATTGATTGGCAACCCGGAGGAGTTTACCCCG
GGTCCTTCCTCTAGCTTCCCTCATCTCCTCCGCATGGTATGTCGCGCGGATTTGCAGGCTTATGAGGATTTCCGC
GATTTGCTGGTACTCTCTCGGAGCTCAAAACCTCCCAGTCGTGCTGCTAGTGGGTCATATGGAGGCCTCAACGTG
ATGGGCCTGGCAAGCTTTGCGAGTGGAGGGTCTCCATCGTCGACCTCATCACCTACCAAAGGGTTTAGCTACTCC
CCTAATGGGAGCATATCTTCCACAACGGGTTCGGGATTTTCCTTGAAGGAAACTCGCTTCTACAAGCGGGTGCTT
ATGGAGGATATCGAACCTACATTGCGACTAGATCTAGCGCCGGGGATTTCTTGGTTGACGCGGCGTACCGTTCTA
AGTGGTATCTGCGAAGGCAGTCTCGTCGTCGAGCCAATGCCCACATCAGCTCAGAAATTCGAGTTCCCCTGCTCT
GTCTGTGGTGAACGCAGACCCGGCACGTCTAATGCGAGAACCCATCGTTTCCGAACGTCAGACAGCGAGACTGCT
CAAAGGTACTCACTTTGCATTCTCTGCTTAGAAAGAGTGCGCTCATGTTGCGAGTTCACTGGCTACTTGCGTCTC
ATCCTTGATGGACATCTTCGGGCTGGGGATACCGAAGAAGAAAAGGAAATCTGGGATGAGACTATCCGTCTCAGA
GAGAGGATGTTCTGGTCCCGCGTCGGAGGAGGCATCATTCCATTGGGCAATCGCCCAAGCGAACCGGAGGTGCCG
GCCAGCACAGAGCCTAATACTGGCGTCCAAGACGATGCCGACCAGTATCTCTATCCTGTGGACGTTACTTATCTC
GAGCCCAGGACAGAAAAAGTACCCGTTGCTGATCAAATCGCGCCGGAAACACCAGTTAGAGCATCCACTACTGAT
CATATAACCCCCCCTGATCTTTCTCGACCTCAAAGCCCTATGTATGACAGGGATGATGCTGCTTCTTTGGATGAC
TTGCAACGCAAGCGACTTTCTATTGATTCAGCAGCAAGCGTTTATGAAGAAGCCAGCACTGACGTGGATGCCAAT
ACCACGGCACCTGCCCCCAACGAACCCTCGATTATTCAGAGTCGAGAGACAGACACAGACATCGCCAAACCCAAT
GGTTTGAGCGACTCTTTACCTCGGTTGATCACAAGCGATCAACACGAGTGA
Gene >Pro_DTO377G3_2|g6831.t1
ATGGCCGAGTAAGTATCCATCAAGATTTCCGCGACTTCAATTATTGACGCTTTAGGTGGGGCAGTTTAATTGCCT
TTCAGACCTCGCATCATAGCTTCTTCTCCCCATCCAAAATGATCTCGCGCAACTCCCATAAGAGGTCGCTCTCCT
CCGAGCACCGGTCCTTATCTCCTGACCGAACCGTCACGAAAGCCAAGTCCACCACCAATCTCTCCGAGATCGCCG
CTGCCAATGCAGCACAAAACTCCGGATATTACGAAAGCAGTTTTAGCACATTGCAAGACCCGCGATTGCTGATCG
GGTCGGAGGTCTCGCATTCGACGTCATCGTCTCACCACCCGGATCTGAGCAACGAAGTAGCGGCATTGTCTGTGA
AATTGATCCAGGCTATCAACAACCAAACAAACCTTGACGATAATCTGGTCGCTACTCGGCAAGAGCTAGAGCTGG
CTCAGGGCAAAATTCAAGCTCTGGAGTACCAGAACGAGAAATATCGGCGAGATATTGATAACCAAGTCTATATAA
AGAAGGTCGACTCTGATCGCGAAATTTCGCAATTACGAGATGCATTAGCAGAAGAAACGACCTTGCGTCTCGCCG
CTGAAAAGGGCAGGAAAAATATTGAGCAAGAAGTGGAAACTCTCACTGCGGCTCTTTTTGAAGAAGCCAATAAGG
TCGGTAATCTCCTTTAACGTATGCATTTTGTACTAAATTCTAACGTTACTTTAGATGGTAGCTTCGGCTAAAATT
GACCGAGAGGCGGTGGAAAAGAAGAATGAGCAGTTGCGTTCACAAGTCAAAGATACCGAGTTGCTCCTGGCATCG
CACCAAGACCAGCTTGCCGAGCTCAAGTCTGTCATGCAAACGATGAATCTTCACAAAGATGACATGGAAGGACGT
CCCGCTAACAGTCCATCGTCTCCGGACGAGTCACAAGCGCAAGGTTCTAACCAAGACACTGAGTTTGAACCCGTT
CCTATATTGATTGGCAACCCGGAGGAGTTTACCCCGGGTCCTTCCTCTAGCTTCCCTCATCTCCTCCGCATGGTA
TGTCGCGCGGATTTGCAGGCTTATGAGGATTTCCGCGATTTGCTGGTACTCTCTCGGAGCTCAAAACCTCCCAGT
CGTGCTGCTAGTGGGTCATATGGAGGCCTCAACGTGATGGGCCTGGCAAGCTTTGCGAGTGGAGGGTCTCCATCG
TCGACCTCATCACCTACCAAAGGGTTTAGCTACTCCCCTAATGGGAGCATATCTTCCACAACGGGTTCGGGATTT
TCCTTGAAGGAAACTCGCTTCTACAAGCGGGTGCTTATGGAGGATATCGAACCTACATTGCGACTAGATCTAGCG
CCGGGGATTTCTTGGTTGACGCGGCGTACCGTTCTAAGTGGTATCTGCGAAGGCAGTCTCGTCGTCGAGCCAATG
CCCACATCAGCTCAGAAATTCGAGTTCCCCTGCTCTGTCTGTGGTGAACGCAGACCCGGCACGTCTAATGCGAGA
ACCCATCGTTTCCGAACGTCAGACAGCGAGACTGCTCAAAGGTACTCACTTTGCATTCTCTGCTTAGAAAGAGTG
CGCTCATGTTGCGAGTTCACTGGCTACTTGCGTCTCATCCTTGATGGACATCTTCGGGCTGGGGATACCGAAGAA
GAAAAGGAAATCTGGGATGAGACTATCCGTCTCAGAGAGAGGATGTTCTGGTCCCGCGTCGGAGGAGGCATCATT
CCATTGGGCAATCGCCCAAGCGAACCGGAGGTGCCGGCCAGCACAGAGCCTAATACTGGCGTCCAAGACGATGCC
GACCAGTATCTCTATCCTGTGGACGTTACTTATCTCGAGCCCAGGACAGAAAAAGTACCCGTTGCTGATCAAATC
GCGCCGGAAACACCAGTTAGAGCATCCACTACTGATCATATAACCCCCCCTGATCTTTCTCGACCTCAAAGCCCT
ATGTATGACAGGGATGATGCTGCTTCTTTGGATGACTTGCAACGCAAGCGACTTTCTATTGATTCAGCAGCAAGC
GTTTATGAAGAAGCCAGCACTGACGTGGATGCCAATACCACGGCACCTGCCCCCAACGAACCCTCGATTATTCAG
AGTCGAGAGACAGACACAGACATCGCCAAACCCAATGGTTTGAGCGACTCTTTACCTCGGTTGATCACAAGCGAT
CAACACGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail