Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6823.t1
Gene name
Locationscaffold_19:113292..114449
Strand-
Gene length (bp)1157
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02104 SURF1 SURF1 family 3.9E-54 82 291

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 74 96 22
2 282 301 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6823.t1
MRPIFSALQKTSARAWTPPTRALRNPRVPSKINSLCAKYRLHQFRHISQSRQLADGLNIVDHPARLVRVNKKHGP
GLIILALIPIISFILGTWQVQRLGWKTKLMAKFEDRLVKPPLPLPPRVDPDAISEFDYRRVYATGHFRHDKEMLV
GPRMNEGEDGFIVVTPLEREGQSTVLVNRGWISRKLKDQKDRPLGVPDGEVTVEGLLREPWKKNMFTPDNKPDEG
KFYFPDINQMAEKSGSQPVWIEQTMVPDFLESCDREAKGIPIGRAAEVNLRNNHSQYIFTWYGLSLATTIMMWMV
VRKNPNEALRRVRQNRNW*
Coding >Pro_DTO377G3_2|g6823.t1
ATGCGGCCAATCTTCTCTGCTTTGCAGAAGACATCCGCGAGGGCCTGGACGCCTCCGACTCGCGCTCTTCGAAAC
CCTCGTGTACCATCCAAGATCAATTCCCTCTGCGCCAAATACCGCCTACACCAATTCCGCCATATCTCTCAATCA
CGCCAGCTGGCCGATGGTCTGAATATTGTAGACCACCCGGCGCGGCTTGTGCGTGTTAATAAGAAACATGGACCT
GGTCTGATCATCTTGGCTCTGATCCCTATAATCTCATTTATCCTGGGAACATGGCAGGTACAGCGTTTGGGCTGG
AAAACCAAATTAATGGCCAAATTCGAGGACCGTCTCGTGAAACCTCCTCTGCCACTGCCGCCGCGAGTCGACCCG
GATGCCATTTCAGAGTTCGACTACCGCCGCGTGTACGCTACCGGCCATTTCCGTCATGACAAAGAAATGCTGGTT
GGCCCCCGCATGAACGAAGGAGAGGACGGGTTCATCGTAGTGACTCCCCTCGAGCGAGAGGGACAGAGCACCGTA
CTTGTGAACCGGGGTTGGATCTCAAGGAAATTGAAGGACCAAAAGGACCGACCTTTGGGTGTACCGGATGGAGAG
GTGACCGTGGAAGGTTTACTACGAGAGCCATGGAAGAAAAACATGTTCACGCCGGATAACAAGCCGGACGAGGGC
AAGTTCTACTTCCCGGATATCAATCAGATGGCAGAGAAGAGCGGGAGCCAGCCTGTTTGGATTGAGCAGACAATG
GTTCCTGACTTCCTCGAGTCTTGTGATCGCGAGGCTAAGGGTATCCCGATTGGCCGCGCCGCGGAGGTGAATTTG
AGAAACAACCATTCTCAATACATCTTCACCTGGTATGGCCTGTCTTTGGCCACGACCATCATGATGTGGATGGTT
GTACGGAAGAACCCCAACGAGGCACTGCGCCGAGTTCGCCAGAACCGAAACTGGTAA
Transcript >Pro_DTO377G3_2|g6823.t1
ATGCGGCCAATCTTCTCTGCTTTGCAGAAGACATCCGCGAGGGCCTGGACGCCTCCGACTCGCGCTCTTCGAAAC
CCTCGTGTACCATCCAAGATCAATTCCCTCTGCGCCAAATACCGCCTACACCAATTCCGCCATATCTCTCAATCA
CGCCAGCTGGCCGATGGTCTGAATATTGTAGACCACCCGGCGCGGCTTGTGCGTGTTAATAAGAAACATGGACCT
GGTCTGATCATCTTGGCTCTGATCCCTATAATCTCATTTATCCTGGGAACATGGCAGGTACAGCGTTTGGGCTGG
AAAACCAAATTAATGGCCAAATTCGAGGACCGTCTCGTGAAACCTCCTCTGCCACTGCCGCCGCGAGTCGACCCG
GATGCCATTTCAGAGTTCGACTACCGCCGCGTGTACGCTACCGGCCATTTCCGTCATGACAAAGAAATGCTGGTT
GGCCCCCGCATGAACGAAGGAGAGGACGGGTTCATCGTAGTGACTCCCCTCGAGCGAGAGGGACAGAGCACCGTA
CTTGTGAACCGGGGTTGGATCTCAAGGAAATTGAAGGACCAAAAGGACCGACCTTTGGGTGTACCGGATGGAGAG
GTGACCGTGGAAGGTTTACTACGAGAGCCATGGAAGAAAAACATGTTCACGCCGGATAACAAGCCGGACGAGGGC
AAGTTCTACTTCCCGGATATCAATCAGATGGCAGAGAAGAGCGGGAGCCAGCCTGTTTGGATTGAGCAGACAATG
GTTCCTGACTTCCTCGAGTCTTGTGATCGCGAGGCTAAGGGTATCCCGATTGGCCGCGCCGCGGAGGTGAATTTG
AGAAACAACCATTCTCAATACATCTTCACCTGGTATGGCCTGTCTTTGGCCACGACCATCATGATGTGGATGGTT
GTACGGAAGAACCCCAACGAGGCACTGCGCCGAGTTCGCCAGAACCGAAACTGGTAA
Gene >Pro_DTO377G3_2|g6823.t1
ATGCGGCCAATCTTCTCTGCTTTGCAGAAGACATCCGCGAGGGCCTGGACGCCTCCGACTCGCGCTCTTCGAAAC
CCTCGTGTACCATCCAAGATCAATTCCCTCTGCGCCAAATACCGCCTACACCAATTCCGCCATATCTCTCAATCA
CGCCAGCTGGCCGATGGTCTGAATATTGTAGACCACCCGGCGCGGCTTGTGCGTGTTAATAAGAAACATGGACCT
GGTCTGATCATCTTGGGTATGTTAATGTTCAATGCTACATATCCTCGGAAATGCTATATTTAGAGATAATTACTA
ACGTATTGTTCTACACTATAGCTCTGATCCCTATAATCTCATTTATCCTGGGAACATGGCAGGTACAGCGTTTGG
GCTGGAAAACCAAATTAATGGCCAAATTCGAGGACCGTCTCGTGAAACCTCCTCTGCCACTGCCGCCGCGAGTCG
ACCCGGATGCCATTTCAGAGTTCGACTACCGCCGCGTGTACGCTACCGGCCATTTCCGTCATGACAAAGAAATGC
TGGTTGGCCCCCGCATGAACGAAGGAGAGGACGGGTTCATCGTAGTGACTCCCCTCGAGCGAGAGGGACAGAGCA
CCGTACTTGTGAACCGGGGTTGGATCTCAAGGAAATTGAAGGACCAAAAGGACCGACCTTTGGGTGTACCGGATG
GAGAGGTGACCGTGGAAGGTTTACTACGAGAGCCATGGAAGAAAAACATGTTCACGCCGGATAACAAGCCGGACG
AGGGCAAGTTCTACTTCCCGGATATCAATCAGATGGCAGAGAAGAGCGGGAGCCAGCCTGTTTGGATTGAGCAGA
CAATGGGTAATGAGCCTATATTGAATAATCTTGCTCATTCATGGCTAACATTGATTTGCGTTTCTAGTTCCTGAC
TTCCTCGAGTCTTGTGATCGCGAGGCTAAGGGTATCCCGATTGGCCGCGCCGCGGAGGTGAATTTGAGAAACAAC
CATTCTCAATACATCTTCACCTGGTAAGTTAGATCCGTTGTGCTTTTCCCTCCCATTCGAGATTGTCGCTCATAC
TTTGCAGGTATGGCCTGTCTTTGGCCACGACCATCATGATGTGGATGGTTGTACGGAAGAACCCCAACGAGGCAC
TGCGCCGAGTTCGCCAGAACCGAAACTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail