Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6815.t1
Gene name
Locationscaffold_19:96435..97351
Strand-
Gene length (bp)916
Transcript length (bp)645
Coding sequence length (bp)645
Protein length (aa) 215

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12326 EOS1 N-glycosylation protein 1.7E-12 56 138

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0034599 cellular response to oxidative stress Yes
GO:0042221 response to chemical No
GO:0008150 biological_process No
GO:0016020 membrane No
GO:0009987 cellular process No
GO:0006950 response to stress No
GO:0051716 cellular response to stimulus No
GO:0070887 cellular response to chemical stimulus No
GO:0006979 response to oxidative stress No
GO:0033554 cellular response to stress No
GO:0031090 organelle membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0050896 response to stimulus No
GO:0062197 cellular response to chemical stress No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 57 75 18
2 90 112 22
3 121 140 19
4 150 169 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6815.t1
MAPSQHCTRGLLSSSEWTAGGIFPCWPGMGREGWAAAIVGSVGQEWDVERRFRVTEVALAIMWCCASAYLSYFFA
DCMMSRWLLNYTPPAVVIRLLTTNGLIAYITSWVLYLSGASSDPRLLLPAWISITTSLTFVYHATQNHATIKRET
AASLLVVSVASFLSMSSLLMQLHLTRENEPEVPVFVITRKLWDWAVAIFLRMRIADDRIPMGEL*
Coding >Pro_DTO377G3_2|g6815.t1
ATGGCCCCAAGTCAGCACTGCACCCGCGGGTTGCTGTCATCCTCGGAGTGGACCGCAGGTGGTATATTCCCCTGC
TGGCCGGGTATGGGACGAGAGGGGTGGGCGGCGGCGATTGTTGGTAGTGTTGGACAGGAATGGGATGTTGAGAGG
AGATTTCGTGTGACAGAGGTGGCATTGGCTATTATGTGGTGCTGTGCATCCGCATATCTTTCCTATTTCTTTGCT
GATTGCATGATGTCCCGTTGGCTTTTAAACTACACACCACCAGCCGTTGTGATTCGTCTTCTTACAACTAACGGT
TTGATTGCATATATCACTTCTTGGGTCCTTTACCTATCTGGTGCATCCTCTGACCCTAGACTCCTTTTACCAGCC
TGGATCTCCATAACAACCTCTTTAACATTTGTTTACCACGCAACGCAAAACCATGCAACCATCAAACGCGAAACA
GCAGCATCGCTACTAGTCGTTTCCGTCGCAAGCTTCCTAAGCATGTCCTCGCTCCTCATGCAGCTGCATCTGACC
CGTGAAAACGAACCAGAAGTGCCTGTCTTCGTCATTACCCGCAAACTTTGGGACTGGGCTGTGGCCATCTTCCTG
CGCATGCGAATTGCGGATGACCGTATTCCTATGGGAGAGCTATAG
Transcript >Pro_DTO377G3_2|g6815.t1
ATGGCCCCAAGTCAGCACTGCACCCGCGGGTTGCTGTCATCCTCGGAGTGGACCGCAGGTGGTATATTCCCCTGC
TGGCCGGGTATGGGACGAGAGGGGTGGGCGGCGGCGATTGTTGGTAGTGTTGGACAGGAATGGGATGTTGAGAGG
AGATTTCGTGTGACAGAGGTGGCATTGGCTATTATGTGGTGCTGTGCATCCGCATATCTTTCCTATTTCTTTGCT
GATTGCATGATGTCCCGTTGGCTTTTAAACTACACACCACCAGCCGTTGTGATTCGTCTTCTTACAACTAACGGT
TTGATTGCATATATCACTTCTTGGGTCCTTTACCTATCTGGTGCATCCTCTGACCCTAGACTCCTTTTACCAGCC
TGGATCTCCATAACAACCTCTTTAACATTTGTTTACCACGCAACGCAAAACCATGCAACCATCAAACGCGAAACA
GCAGCATCGCTACTAGTCGTTTCCGTCGCAAGCTTCCTAAGCATGTCCTCGCTCCTCATGCAGCTGCATCTGACC
CGTGAAAACGAACCAGAAGTGCCTGTCTTCGTCATTACCCGCAAACTTTGGGACTGGGCTGTGGCCATCTTCCTG
CGCATGCGAATTGCGGATGACCGTATTCCTATGGGAGAGCTATAG
Gene >Pro_DTO377G3_2|g6815.t1
ATGGCCCCAAGTCAGCACTGCACCCGCGGGTTGCTGTCATCCTCGGAGTGGACCGCAGGTGGTATATTCCCCTGC
TGGTATGTCGGGCTCTGAGCACGCTTCCTGCTGCCTGGTGGGGTTTGCGATGCGCTTTTACCTTCCTCGCCGAAT
TGCTGCATATAAGGCCGGGTATGGGACGAGAGGGGTGGGCGGCGGCGATTGTTGGTAGTGTTGGACAGGAATGGG
ATGTTGAGAGGAGATTTCGTGTGACAGAGGTGGCATTGGCTATTATGTGGGTATGTATTCCCTTGATATGCTATC
CTCCAACGGCCTACTCTTATACTGACTACTTGACAGTGCTGTGCATCCGCATATCTTTCCTATTTCTTTGCTGAT
TGCATGATGTCCCGTTGGTTGGTTTTCTCAACCCTTGACGTCCCACTATGTCCATAATGCTAATCTGTGATATAC
TCAGGCTTTTAAACTACACACCACCAGCCGTTGTGATTCGTCTTCTTACAACTAACGGTTTGATTGCATATATCA
CTTCTTGGGTCCTTTACCTATCTGGTGCATCCTCTGACCCTAGACTCCTTTTACCAGCCTGGATCTCCATAACAA
CCGTACGTTACATTGACTTCCAATTGTTCATCGACCTTGCAACAGCCACTGACCCTTCGCCTAGTCTTTAACATT
TGTTTACCACGCAACGCAAAACCATGCAACCATCAAACGCGAAACAGCAGCATCGCTACTAGTCGTTTCCGTCGC
AAGCTTCCTAAGCATGTCCTCGCTCCTCATGCAGCTGCATCTGACCCGTGAAAACGAACCAGAAGTGCCTGTCTT
CGTCATTACCCGCAAACTTTGGGACTGGGCTGTGGCCATCTTCCTGCGCATGCGAATTGCGGATGACCGTATTCC
TATGGGAGAGCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail