Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6804.t1
Gene name
Locationscaffold_19:68078..70472
Strand+
Gene length (bp)2394
Transcript length (bp)2256
Coding sequence length (bp)2256
Protein length (aa) 752

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 1.3E-21 230 463
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 2.5E-18 330 516
PF00535 Glycos_transf_2 Glycosyl transferase family 2 1.2E-13 232 411
PF03552 Cellulose_synt Cellulose synthase 6.7E-08 387 535
PF13506 Glyco_transf_21 Glycosyl transferase family 21 3.2E-10 326 462

GO

GO Term Description Terminal node
GO:0030244 cellulose biosynthetic process Yes
GO:0016020 membrane Yes
GO:0016760 cellulose synthase (UDP-forming) activity Yes
GO:0016757 glycosyltransferase activity Yes
GO:0030243 cellulose metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044264 cellular polysaccharide metabolic process No
GO:0051273 beta-glucan metabolic process No
GO:0016740 transferase activity No
GO:0005575 cellular_component No
GO:0016051 carbohydrate biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044042 glucan metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0008150 biological_process No
GO:0006073 cellular glucan metabolic process No
GO:0035251 UDP-glucosyltransferase activity No
GO:0016758 hexosyltransferase activity No
GO:0008194 UDP-glycosyltransferase activity No
GO:0046527 glucosyltransferase activity No
GO:0003824 catalytic activity No
GO:0033692 cellular polysaccharide biosynthetic process No
GO:0000271 polysaccharide biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009987 cellular process No
GO:0009059 macromolecule biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0051274 beta-glucan biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0009250 glucan biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0003674 molecular_function No
GO:0009058 biosynthetic process No
GO:0005976 polysaccharide metabolic process No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0016759 cellulose synthase activity No
GO:0044262 cellular carbohydrate metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 147 169 22
2 182 204 22
3 497 519 22
4 532 554 22
5 569 591 22
6 624 646 22
7 661 683 22
8 727 749 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6804.t1
MDRRGGHDEDEKVELNAYPANHSNHSFESQPFSPSPVTPRPLTPVRPGHFPTDEYGQPVWLQPTARMSGNSDSFH
NSSWDLRTPYDSRSASPTLYQNNGVQESHQSLAPLVSSPAPPGFAKDWVKSGSIARINDRDDADTWKGWKRWVFA
LVPFLTFANTGIYLFYLGLRIACIIMAQNVSGVSYAGAWVFVAIEITVAIPSLMHNCWTMMALKKRGRAKLRLTG
NDCPTVDVFITCCGEDDEVVLDTVRGACDQDYPPDQMRVIILDDAKSATLEAGCNQLAVNHPNIIYMAREKIPGK
PHHFKAGNLNYGLEQVTLLPGGAGQFMAALDADMIPEQEWLRAILPHLLVDPKMALACPPQLFYNTPASDPLAQS
LDFFVHVIEPIKDALGVAWCTGSGYVVRREALEEIGNFPLGSLAEDVATSTLMLGKGWKTAYIHEPLQFGTVPED
FGGHLKQRTRWAIGTVDTAAKLKFCLWGDAVRQMTAAQRFSGFLYATLSVYTLLLTASLFAIPIILLWGKRLVAF
ATEEQLRWLIWSCFAATISNRLCELALFIPAGYNTGQRGSRYQLWMSPYIALCIVRAFILPTWLGGQTQAFKPTG
SLGSALNERDPNKSKNMFVRLRVILLNYMASFHLAFVYVTLIGVVISSYRCFAQNSGFRDIILCLITHAFWPPLT
FLFICTSLWTPVSYAIDPPRMPEREELLTRDPKTGVAHPTKKSKKIAFGGQAAWFELEYTVATVVTILVFIYSFM
F*
Coding >Pro_DTO377G3_2|g6804.t1
ATGGACAGGCGTGGTGGTCATGACGAGGACGAAAAGGTAGAACTGAATGCCTATCCTGCCAACCATTCAAACCAC
AGCTTCGAATCTCAGCCTTTTTCACCCTCACCAGTAACTCCAAGGCCTCTCACTCCAGTCAGACCGGGTCATTTC
CCTACCGATGAATACGGGCAACCCGTTTGGCTTCAACCCACCGCTCGAATGTCGGGCAACTCCGATTCCTTTCAC
AACTCCTCCTGGGACCTACGAACGCCGTATGATTCCCGGTCGGCTTCACCCACTCTATATCAAAACAATGGAGTG
CAAGAAAGCCACCAGAGTCTAGCTCCCCTAGTGAGCTCCCCGGCTCCCCCGGGATTTGCAAAGGATTGGGTCAAG
TCTGGATCGATTGCTCGAATTAACGACCGTGATGATGCGGATACATGGAAAGGGTGGAAGAGATGGGTATTTGCC
CTGGTACCGTTTCTCACATTCGCCAACACCGGAATCTACTTGTTCTACCTCGGGCTGAGAATTGCCTGCATTATC
ATGGCTCAAAATGTTTCTGGAGTTTCATATGCCGGAGCTTGGGTTTTTGTGGCTATCGAGATCACTGTTGCAATC
CCCTCCCTCATGCACAACTGTTGGACTATGATGGCGTTGAAGAAGAGAGGCCGTGCCAAGCTGAGATTGACCGGC
AATGACTGTCCGACAGTGGATGTGTTTATTACCTGCTGTGGAGAGGATGATGAAGTGGTCCTCGATACTGTCCGT
GGTGCGTGTGACCAGGACTACCCTCCCGACCAGATGAGGGTTATCATCTTGGACGACGCCAAGTCTGCCACCCTC
GAGGCTGGCTGCAACCAACTCGCTGTGAATCACCCCAACATCATTTACATGGCTCGTGAAAAGATCCCCGGAAAA
CCCCACCACTTCAAGGCAGGTAATCTGAACTACGGTCTGGAGCAGGTCACCCTTTTGCCTGGAGGCGCCGGCCAG
TTCATGGCCGCCCTGGACGCTGATATGATTCCTGAACAAGAGTGGCTTCGTGCGATTCTTCCCCACTTGTTGGTG
GATCCCAAAATGGCCCTTGCATGCCCGCCGCAGCTTTTCTACAATACCCCTGCATCCGACCCGCTTGCCCAGAGT
TTGGATTTCTTCGTGCATGTTATTGAGCCGATCAAGGATGCCCTCGGTGTGGCTTGGTGCACTGGATCTGGTTAC
GTCGTTCGACGCGAGGCGCTCGAAGAGATTGGCAACTTCCCGCTCGGTTCCTTGGCTGAAGATGTCGCGACCTCC
ACACTCATGCTTGGCAAAGGATGGAAAACCGCATACATCCACGAGCCGCTTCAATTTGGTACCGTGCCGGAAGAC
TTTGGTGGACATCTCAAGCAGCGTACGCGATGGGCAATTGGAACCGTCGACACCGCTGCCAAGCTGAAGTTCTGT
CTCTGGGGTGACGCCGTTCGACAGATGACCGCTGCTCAACGATTCTCCGGCTTCCTCTATGCAACTCTCAGTGTC
TATACCCTCCTGCTCACCGCTTCCCTCTTTGCTATCCCGATCATCCTCTTGTGGGGCAAGCGCCTTGTCGCCTTT
GCGACAGAAGAGCAACTCCGCTGGCTGATCTGGTCCTGCTTCGCCGCCACTATCTCCAACCGTCTGTGCGAACTG
GCCCTGTTCATCCCGGCGGGCTATAACACCGGCCAGCGAGGCTCCCGCTATCAACTTTGGATGTCACCCTATATC
GCTCTCTGTATTGTGCGCGCCTTCATCCTCCCCACCTGGCTGGGCGGTCAAACCCAAGCCTTCAAGCCCACTGGT
TCGCTGGGCTCAGCTCTGAACGAGCGCGACCCGAACAAGTCCAAGAACATGTTCGTCCGCCTGCGCGTGATCTTA
CTCAACTACATGGCCAGCTTCCACCTTGCCTTTGTCTACGTCACCCTCATCGGAGTCGTCATCTCCTCTTACCGC
TGTTTCGCCCAGAACAGTGGCTTCCGAGATATCATCCTCTGCCTCATCACGCATGCTTTCTGGCCTCCACTGACC
TTCCTTTTCATTTGCACTTCGCTGTGGACCCCGGTCTCGTATGCGATCGACCCGCCACGCATGCCGGAGCGTGAA
GAACTCCTTACACGTGACCCTAAGACTGGTGTGGCGCACCCGACGAAGAAGAGTAAAAAGATCGCCTTCGGTGGC
CAGGCCGCTTGGTTCGAGCTTGAATACACGGTTGCCACCGTGGTCACAATTTTGGTCTTCATCTACTCGTTTATG
TTCTAA
Transcript >Pro_DTO377G3_2|g6804.t1
ATGGACAGGCGTGGTGGTCATGACGAGGACGAAAAGGTAGAACTGAATGCCTATCCTGCCAACCATTCAAACCAC
AGCTTCGAATCTCAGCCTTTTTCACCCTCACCAGTAACTCCAAGGCCTCTCACTCCAGTCAGACCGGGTCATTTC
CCTACCGATGAATACGGGCAACCCGTTTGGCTTCAACCCACCGCTCGAATGTCGGGCAACTCCGATTCCTTTCAC
AACTCCTCCTGGGACCTACGAACGCCGTATGATTCCCGGTCGGCTTCACCCACTCTATATCAAAACAATGGAGTG
CAAGAAAGCCACCAGAGTCTAGCTCCCCTAGTGAGCTCCCCGGCTCCCCCGGGATTTGCAAAGGATTGGGTCAAG
TCTGGATCGATTGCTCGAATTAACGACCGTGATGATGCGGATACATGGAAAGGGTGGAAGAGATGGGTATTTGCC
CTGGTACCGTTTCTCACATTCGCCAACACCGGAATCTACTTGTTCTACCTCGGGCTGAGAATTGCCTGCATTATC
ATGGCTCAAAATGTTTCTGGAGTTTCATATGCCGGAGCTTGGGTTTTTGTGGCTATCGAGATCACTGTTGCAATC
CCCTCCCTCATGCACAACTGTTGGACTATGATGGCGTTGAAGAAGAGAGGCCGTGCCAAGCTGAGATTGACCGGC
AATGACTGTCCGACAGTGGATGTGTTTATTACCTGCTGTGGAGAGGATGATGAAGTGGTCCTCGATACTGTCCGT
GGTGCGTGTGACCAGGACTACCCTCCCGACCAGATGAGGGTTATCATCTTGGACGACGCCAAGTCTGCCACCCTC
GAGGCTGGCTGCAACCAACTCGCTGTGAATCACCCCAACATCATTTACATGGCTCGTGAAAAGATCCCCGGAAAA
CCCCACCACTTCAAGGCAGGTAATCTGAACTACGGTCTGGAGCAGGTCACCCTTTTGCCTGGAGGCGCCGGCCAG
TTCATGGCCGCCCTGGACGCTGATATGATTCCTGAACAAGAGTGGCTTCGTGCGATTCTTCCCCACTTGTTGGTG
GATCCCAAAATGGCCCTTGCATGCCCGCCGCAGCTTTTCTACAATACCCCTGCATCCGACCCGCTTGCCCAGAGT
TTGGATTTCTTCGTGCATGTTATTGAGCCGATCAAGGATGCCCTCGGTGTGGCTTGGTGCACTGGATCTGGTTAC
GTCGTTCGACGCGAGGCGCTCGAAGAGATTGGCAACTTCCCGCTCGGTTCCTTGGCTGAAGATGTCGCGACCTCC
ACACTCATGCTTGGCAAAGGATGGAAAACCGCATACATCCACGAGCCGCTTCAATTTGGTACCGTGCCGGAAGAC
TTTGGTGGACATCTCAAGCAGCGTACGCGATGGGCAATTGGAACCGTCGACACCGCTGCCAAGCTGAAGTTCTGT
CTCTGGGGTGACGCCGTTCGACAGATGACCGCTGCTCAACGATTCTCCGGCTTCCTCTATGCAACTCTCAGTGTC
TATACCCTCCTGCTCACCGCTTCCCTCTTTGCTATCCCGATCATCCTCTTGTGGGGCAAGCGCCTTGTCGCCTTT
GCGACAGAAGAGCAACTCCGCTGGCTGATCTGGTCCTGCTTCGCCGCCACTATCTCCAACCGTCTGTGCGAACTG
GCCCTGTTCATCCCGGCGGGCTATAACACCGGCCAGCGAGGCTCCCGCTATCAACTTTGGATGTCACCCTATATC
GCTCTCTGTATTGTGCGCGCCTTCATCCTCCCCACCTGGCTGGGCGGTCAAACCCAAGCCTTCAAGCCCACTGGT
TCGCTGGGCTCAGCTCTGAACGAGCGCGACCCGAACAAGTCCAAGAACATGTTCGTCCGCCTGCGCGTGATCTTA
CTCAACTACATGGCCAGCTTCCACCTTGCCTTTGTCTACGTCACCCTCATCGGAGTCGTCATCTCCTCTTACCGC
TGTTTCGCCCAGAACAGTGGCTTCCGAGATATCATCCTCTGCCTCATCACGCATGCTTTCTGGCCTCCACTGACC
TTCCTTTTCATTTGCACTTCGCTGTGGACCCCGGTCTCGTATGCGATCGACCCGCCACGCATGCCGGAGCGTGAA
GAACTCCTTACACGTGACCCTAAGACTGGTGTGGCGCACCCGACGAAGAAGAGTAAAAAGATCGCCTTCGGTGGC
CAGGCCGCTTGGTTCGAGCTTGAATACACGGTTGCCACCGTGGTCACAATTTTGGTCTTCATCTACTCGTTTATG
TTCTAA
Gene >Pro_DTO377G3_2|g6804.t1
ATGGACAGGCGTGGTGGTCATGACGAGGACGAAAAGGTAGAACTGAATGCCTATCCTGCCAACCATTCAAACCAC
AGCTTCGAATCTCAGCCTTTTTCACCCTCACCAGTAACTCCAAGGCCTCTCACTCCAGTCAGACCGGGTCATTTC
CCTACCGATGAATACGGGCAACCCGTTTGGCTTCAACCCACCGCTCGAATGTCGGGCAACTCCGATTCCTTTCAC
AACTCCTCCTGGGACCTACGAACGCCGTATGATTCCCGGTCGGCTTCACCCACTCTAGTTAGTACAGTCCGTCTT
TGTTTCTTTGGTCTCTTTGTTGTCGGTATAGATCCAGCCTAACCGGTTTCCCATACAGTATCAAAACAATGGAGT
GCAAGAAAGCCACCAGAGTCTAGCTCCCCTAGTGAGCTCCCCGGCTCCCCCGGGATTTGCAAAGGATTGGGTCAA
GTCTGGATCGATTGCTCGAATTAACGACCGTGATGATGCGGATACATGGAAAGGGTGGAAGAGATGGGTATTTGC
CCTGGTACCGTTTCTCACATTCGCCAACACCGGAATCTACTTGTTCTACCTCGGGCTGAGAATTGCCTGCATTAT
CATGGCTCAAAATGTTTCTGGAGTTTCATATGCCGGAGCTTGGGTTTTTGTGGCTATCGAGATCACTGTTGCAAT
CCCCTCCCTCATGCACAACTGTTGGACTATGATGGCGTTGAAGAAGAGAGGCCGTGCCAAGCTGAGATTGACCGG
CAATGACTGTCCGACAGTGGATGTGTTTATTACCTGCTGTGGAGAGGATGATGAAGTGGTCCTCGATACTGTCCG
TGGTGCGTGTGACCAGGACTACCCTCCCGACCAGATGAGGGTTATCATCTTGGACGACGCCAAGTCTGCCACCCT
CGAGGCTGGCTGCAACCAACTCGCTGTGAATCACCCCAACATCATTTACATGGCTCGTGAAAAGATCCCCGGAAA
ACCCCACCACTTCAAGGCAGGTAATCTGAACTACGGTCTGGAGCAGGTCACCCTTTTGCCTGGAGGCGCCGGCCA
GTTCATGGCCGCCCTGGACGCTGATATGGTAAGTTACAGGTCCCGGCCTACGTTGAAATTGAAATTCCTGTACTG
ATTGACAATCTGCAGATTCCTGAACAAGAGTGGCTTCGTGCGATTCTTCCCCACTTGTTGGTGGATCCCAAAATG
GCCCTTGCATGCCCGCCGCAGCTTTTCTACAATACCCCTGCATCCGACCCGCTTGCCCAGAGTTTGGATTTCTTC
GTGCATGTTATTGAGCCGATCAAGGATGCCCTCGGTGTGGCTTGGTGCACTGGATCTGGTTACGTCGTTCGACGC
GAGGCGCTCGAAGAGATTGGCAACTTCCCGCTCGGTTCCTTGGCTGAAGATGTCGCGACCTCCACACTCATGCTT
GGCAAAGGATGGAAAACCGCATACATCCACGAGCCGCTTCAATTTGGTACCGTGCCGGAAGACTTTGGTGGACAT
CTCAAGCAGCGTACGCGATGGGCAATTGGAACCGTCGACACCGCTGCCAAGCTGAAGTTCTGTCTCTGGGGTGAC
GCCGTTCGACAGATGACCGCTGCTCAACGATTCTCCGGCTTCCTCTATGCAACTCTCAGTGTCTATACCCTCCTG
CTCACCGCTTCCCTCTTTGCTATCCCGATCATCCTCTTGTGGGGCAAGCGCCTTGTCGCCTTTGCGACAGAAGAG
CAACTCCGCTGGCTGATCTGGTCCTGCTTCGCCGCCACTATCTCCAACCGTCTGTGCGAACTGGCCCTGTTCATC
CCGGCGGGCTATAACACCGGCCAGCGAGGCTCCCGCTATCAACTTTGGATGTCACCCTATATCGCTCTCTGTATT
GTGCGCGCCTTCATCCTCCCCACCTGGCTGGGCGGTCAAACCCAAGCCTTCAAGCCCACTGGTTCGCTGGGCTCA
GCTCTGAACGAGCGCGACCCGAACAAGTCCAAGAACATGTTCGTCCGCCTGCGCGTGATCTTACTCAACTACATG
GCCAGCTTCCACCTTGCCTTTGTCTACGTCACCCTCATCGGAGTCGTCATCTCCTCTTACCGCTGTTTCGCCCAG
AACAGTGGCTTCCGAGATATCATCCTCTGCCTCATCACGCATGCTTTCTGGCCTCCACTGACCTTCCTTTTCATT
TGCACTTCGCTGTGGACCCCGGTCTCGTATGCGATCGACCCGCCACGCATGCCGGAGCGTGAAGAACTCCTTACA
CGTGACCCTAAGACTGGTGTGGCGCACCCGACGAAGAAGAGTAAAAAGATCGCCTTCGGTGGCCAGGCCGCTTGG
TTCGAGCTTGAATACACGGTTGCCACCGTGGTCACAATTTTGGTCTTCATCTACTCGTTTATGTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail