Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6801.t1
Gene name
Locationscaffold_19:62174..63575
Strand-
Gene length (bp)1401
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.4E-18 40 374
PF05978 UNC-93 Ion channel regulatory protein UNC-93 1.3E-06 68 161

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 65 87 22
3 92 114 22
4 124 146 22
5 158 180 22
6 190 212 22
7 249 271 22
8 281 302 21
9 315 334 19
10 357 379 22
11 419 441 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6801.t1
MAPPVASEVVSEQVQDDSQTITRSRTSWYRSIPFQIAVASGVSFTAPGMWDALNNLGAGGAAEPYAVSAANALVY
GLFAVVCIAAGAINNRIGLRYGLVLGAIGYPIYGAGLYTNTYHTTTWFMLFGSALCGISAGFFWAAEAAIIIGYP
SPKERAFYIAVWQTAKSSGPIVGGAISLGLNAQTAGKGTISASTYIVFIVIMCLGLPISLLLSPAEKVQRKDHSL
VVVNMKESWAKEFKAAFSLIFTRRVLLLLPAFFISYFYNGFQSTWLTTYFTVRSRAFSSFLTNFAGIASSFIMAL
LLDRQTIFIKTRARIAFCSVVALIIGTWIWATILQKQFYDLPESPVFDWFTPGFNKAYALIFFWTFSGQAFQQFL
YWLVGQYSTDISSLSYHCGILRGFEALGQTVAWAMQTEGGANHFVSIGLNFGITVIAFVPTWIVLSELEHSHEVQ
VTVEDVPSKIADEATA*
Coding >Pro_DTO377G3_2|g6801.t1
ATGGCCCCTCCTGTCGCGTCAGAAGTCGTTTCTGAGCAAGTCCAAGATGACTCTCAAACTATCACCAGGTCTCGG
ACTTCATGGTACCGCTCTATCCCCTTCCAGATCGCCGTGGCTAGTGGTGTCTCATTCACTGCCCCTGGAATGTGG
GATGCACTGAACAACCTCGGAGCAGGTGGTGCAGCCGAGCCCTACGCTGTTTCCGCGGCGAACGCTTTGGTCTAC
GGATTATTTGCCGTTGTTTGTATCGCCGCTGGTGCAATCAACAACCGTATTGGTCTACGCTACGGTCTAGTTCTC
GGTGCGATCGGTTACCCGATCTATGGTGCCGGTCTGTACACCAACACATACCACACCACGACATGGTTCATGCTC
TTCGGCTCCGCCCTGTGCGGTATCTCAGCGGGATTTTTCTGGGCTGCCGAGGCCGCTATTATCATTGGTTATCCC
AGTCCCAAGGAGCGCGCTTTCTACATCGCTGTCTGGCAGACCGCGAAATCTTCTGGTCCGATCGTCGGTGGTGCA
ATCAGTCTGGGACTGAACGCACAGACGGCCGGAAAGGGAACGATCAGCGCTTCGACTTATATCGTCTTCATTGTC
ATTATGTGCCTCGGTCTGCCCATTTCGCTCCTACTCAGTCCTGCCGAGAAGGTGCAGCGCAAGGACCACTCTCTT
GTGGTTGTGAACATGAAAGAGAGTTGGGCCAAGGAATTCAAGGCTGCCTTTTCTCTGATCTTCACTCGCCGTGTG
CTCCTCCTCCTGCCAGCCTTCTTCATCAGTTACTTCTACAACGGCTTCCAGAGCACCTGGCTGACCACCTACTTC
ACCGTGCGATCTCGCGCATTCTCATCTTTCCTCACCAACTTCGCCGGAATCGCGTCTTCGTTCATCATGGCGCTG
CTGCTTGATCGCCAGACCATCTTCATCAAGACCCGCGCCAGAATTGCATTCTGCTCCGTCGTTGCCCTGATCATC
GGCACCTGGATCTGGGCTACTATCCTACAGAAGCAGTTCTACGACCTACCCGAGTCCCCGGTGTTCGACTGGTTC
ACACCGGGCTTCAACAAAGCGTACGCGCTGATCTTCTTCTGGACCTTCAGCGGCCAAGCCTTCCAGCAATTCCTC
TACTGGCTGGTCGGCCAGTACAGCACCGACATCTCATCGTTATCCTACCACTGCGGTATCCTGCGTGGATTCGAG
GCTCTGGGACAGACCGTCGCATGGGCCATGCAGACCGAAGGCGGCGCCAACCACTTCGTCAGCATCGGTCTCAAC
TTTGGAATCACGGTTATCGCGTTCGTTCCCACGTGGATTGTCCTGTCGGAATTGGAACACAGCCACGAGGTGCAG
GTCACCGTGGAGGACGTCCCGTCCAAAATAGCCGACGAGGCAACTGCTTAA
Transcript >Pro_DTO377G3_2|g6801.t1
ATGGCCCCTCCTGTCGCGTCAGAAGTCGTTTCTGAGCAAGTCCAAGATGACTCTCAAACTATCACCAGGTCTCGG
ACTTCATGGTACCGCTCTATCCCCTTCCAGATCGCCGTGGCTAGTGGTGTCTCATTCACTGCCCCTGGAATGTGG
GATGCACTGAACAACCTCGGAGCAGGTGGTGCAGCCGAGCCCTACGCTGTTTCCGCGGCGAACGCTTTGGTCTAC
GGATTATTTGCCGTTGTTTGTATCGCCGCTGGTGCAATCAACAACCGTATTGGTCTACGCTACGGTCTAGTTCTC
GGTGCGATCGGTTACCCGATCTATGGTGCCGGTCTGTACACCAACACATACCACACCACGACATGGTTCATGCTC
TTCGGCTCCGCCCTGTGCGGTATCTCAGCGGGATTTTTCTGGGCTGCCGAGGCCGCTATTATCATTGGTTATCCC
AGTCCCAAGGAGCGCGCTTTCTACATCGCTGTCTGGCAGACCGCGAAATCTTCTGGTCCGATCGTCGGTGGTGCA
ATCAGTCTGGGACTGAACGCACAGACGGCCGGAAAGGGAACGATCAGCGCTTCGACTTATATCGTCTTCATTGTC
ATTATGTGCCTCGGTCTGCCCATTTCGCTCCTACTCAGTCCTGCCGAGAAGGTGCAGCGCAAGGACCACTCTCTT
GTGGTTGTGAACATGAAAGAGAGTTGGGCCAAGGAATTCAAGGCTGCCTTTTCTCTGATCTTCACTCGCCGTGTG
CTCCTCCTCCTGCCAGCCTTCTTCATCAGTTACTTCTACAACGGCTTCCAGAGCACCTGGCTGACCACCTACTTC
ACCGTGCGATCTCGCGCATTCTCATCTTTCCTCACCAACTTCGCCGGAATCGCGTCTTCGTTCATCATGGCGCTG
CTGCTTGATCGCCAGACCATCTTCATCAAGACCCGCGCCAGAATTGCATTCTGCTCCGTCGTTGCCCTGATCATC
GGCACCTGGATCTGGGCTACTATCCTACAGAAGCAGTTCTACGACCTACCCGAGTCCCCGGTGTTCGACTGGTTC
ACACCGGGCTTCAACAAAGCGTACGCGCTGATCTTCTTCTGGACCTTCAGCGGCCAAGCCTTCCAGCAATTCCTC
TACTGGCTGGTCGGCCAGTACAGCACCGACATCTCATCGTTATCCTACCACTGCGGTATCCTGCGTGGATTCGAG
GCTCTGGGACAGACCGTCGCATGGGCCATGCAGACCGAAGGCGGCGCCAACCACTTCGTCAGCATCGGTCTCAAC
TTTGGAATCACGGTTATCGCGTTCGTTCCCACGTGGATTGTCCTGTCGGAATTGGAACACAGCCACGAGGTGCAG
GTCACCGTGGAGGACGTCCCGTCCAAAATAGCCGACGAGGCAACTGCTTAA
Gene >Pro_DTO377G3_2|g6801.t1
ATGGCCCCTCCTGTCGCGTCAGAAGTCGTTTCTGAGCAAGTCCAAGATGACTCTCAAACTATCACCAGGTCTCGG
ACTTCATGGTACCGCTCTATCCCCTTCCAGATCGCCGTGGCTAGTGGTGTCTCATTCACTGCCCCTGGAATGTGG
GATGCACTGAACAACCTCGGAGCAGGTGGTGCAGCCGAGCCCTACGCTGTTTCCGCGGCGAACGCTTTGGTCTAC
GGATTATTTGCCGTTGTTTGTATCGCCGCTGGTGCAATCAACAACCGTATTGGTCTACGCTACGGTCTAGTTCTC
GGTGCGATCGGTTACCCGATCTATGGTGCCGGTCTGTACACCAACACATACCACACCACGACATGGTTCATGCTC
TTCGGCTCCGCCCTGTGCGGTATCTCAGCGGGATTTTTCTGGGCTGCCGAGGCCGCTATTATCATTGGTTATCCC
AGTCCCAAGGAGCGCGCTTTCTACATCGCTGTCTGGCAGACCGCGAAATCTTCTGGTCCGATCGTCGGTGGTGCA
ATCAGTCTGGGACTGAACGCACAGACGGCCGGAAAGGGAACGATCAGCGCTTCGACTTATATCGTCTTCATTGTC
ATTATGTGCCTCGGTCTGCCCATTTCGCTCCTACTCAGTCCTGCCGAGAAGGTGCAGCGCAAGGACCACTCTCTT
GTGGTTGTGAACATGAAAGAGAGTTGGGCCAAGGAATTCAAGGCTGCCTTTTCTCTGATCTTCACTCGCCGTGTG
CTCCTCCTCCTGCCAGCCTTCTTCATCAGTTACTTCTACAACGGCTTCCAGAGCACCTGGCTGACCACCTACTTC
ACCGTGCGATCTCGCGCATTCTCATCTTTCCTCACCAACTTCGCCGGAATCGCGTCTTCGTTCATCATGGCGCTG
CTGCTTGATCGCCAGACCATCTTCATCAAGACCCGCGCCAGAATTGCATTCTGCTCCGTCGTTGCCCTGATCATC
GGCACCTGGATCTGGGCTACTATCCTACAGAAGCAGTTCTACGACCTACCCGAGTCCCCGGTGTTCGACTGGTTC
ACACCGGGCTTCAACAAAGCGTACGCGCTGATCTTCTTCTGGACCTTCAGCGGCCAAGCCTTCCAGCAATTCCTC
TACTGGCTGGTCGGCCAGTACAGCACCGACATCTCATCGTTATCCTACCACTGCGGTATCCTGCGTGGATTCGAG
GCTCTGGGACAGACCGTCGCATGGGCCATGCAGACCGAAGGCGGCGCCAACCACTTCGTCAGCATCGGTCTCAAC
TTTGGAATCACGGTTATCGCGTTCGTTCCCACGTGGATTGTCCTGTCGGAATTGGAACACAGCCACGAGGTGCAG
GTCACCGTGGAGGACGTCCCGTCCAAAATAGCCGACGAGGCAACTGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail