Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6792.t1
Gene name
Locationscaffold_19:43513..44559
Strand-
Gene length (bp)1046
Transcript length (bp)867
Coding sequence length (bp)867
Protein length (aa) 289

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00719 Pyrophosphatase Inorganic pyrophosphatase 1.2E-57 46 228

GO

GO Term Description Terminal node
GO:0004427 inorganic diphosphatase activity Yes
GO:0000287 magnesium ion binding Yes
GO:0005737 cytoplasm Yes
GO:0006796 phosphate-containing compound metabolic process Yes
GO:0008152 metabolic process No
GO:0044464 cell part No
GO:0006793 phosphorus metabolic process No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016462 pyrophosphatase activity No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0044424 intracellular part No
GO:0005488 binding No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6792.t1
MTYSIRKIGTPYTLEHRVFVEKDGVPVSPFHDIPLYANEQQTILNMVVEIPRWTNAKQEISKDDFLNPIKQDTKK
GKLRFVRNCFPHKGYLWNYGAFPRTWEDPNSIHPETKAKGDNDPLDVCEIGELVGYTGQVKQVKVLGVMALIDEE
ETDWKIIVIDVNDPLAPKLNDIEDVERQLPGLMRATNEWFRIYKIPDGKPENQFAFSGECKNKKYAEDVIRECSD
AWEKLVTGKTPRGDISLANTTVENSPDRVDQAQLAAIPRNENLPPAPIDGSIDKWFFISGAAV*
Coding >Pro_DTO377G3_2|g6792.t1
ATGACTTACTCCATCCGCAAGATCGGTACCCCATACACTCTCGAGCACCGCGTGTTCGTTGAGAAGGATGGCGTC
CCTGTTTCTCCCTTCCACGACATTCCTCTCTACGCCAACGAGCAGCAAACCATCCTGAACATGGTCGTTGAGATC
CCCCGCTGGACCAACGCCAAGCAGGAGATCTCCAAGGATGATTTCCTCAACCCCATCAAGCAGGACACCAAGAAG
GGCAAGCTCCGCTTCGTCCGCAACTGCTTCCCTCACAAGGGTTACCTCTGGAACTACGGTGCCTTCCCTCGCACT
TGGGAGGACCCCAACTCCATCCACCCCGAGACCAAGGCCAAGGGTGACAACGATCCCCTCGACGTTTGCGAGATT
GGTGAGCTTGTCGGCTACACCGGCCAGGTCAAGCAGGTCAAGGTTCTCGGCGTCATGGCCCTGATTGACGAGGAG
GAGACCGACTGGAAGATCATTGTCATCGACGTCAACGACCCTCTTGCTCCCAAGCTCAACGACATCGAGGATGTC
GAGCGCCAGCTTCCTGGTCTCATGCGCGCCACCAACGAGTGGTTCCGCATTTACAAGATCCCCGACGGAAAGCCC
GAGAACCAGTTCGCCTTCTCCGGCGAGTGCAAGAACAAGAAGTACGCCGAGGATGTCATCCGCGAGTGCTCCGAT
GCCTGGGAGAAGCTTGTCACTGGCAAGACCCCCCGTGGCGATATCAGCCTTGCCAACACCACCGTCGAGAACTCT
CCCGACCGTGTTGACCAGGCCCAGCTCGCTGCCATCCCCCGCAACGAGAACCTCCCCCCTGCTCCCATTGATGGA
AGCATTGACAAGTGGTTCTTCATCTCAGGTGCCGCAGTATAA
Transcript >Pro_DTO377G3_2|g6792.t1
ATGACTTACTCCATCCGCAAGATCGGTACCCCATACACTCTCGAGCACCGCGTGTTCGTTGAGAAGGATGGCGTC
CCTGTTTCTCCCTTCCACGACATTCCTCTCTACGCCAACGAGCAGCAAACCATCCTGAACATGGTCGTTGAGATC
CCCCGCTGGACCAACGCCAAGCAGGAGATCTCCAAGGATGATTTCCTCAACCCCATCAAGCAGGACACCAAGAAG
GGCAAGCTCCGCTTCGTCCGCAACTGCTTCCCTCACAAGGGTTACCTCTGGAACTACGGTGCCTTCCCTCGCACT
TGGGAGGACCCCAACTCCATCCACCCCGAGACCAAGGCCAAGGGTGACAACGATCCCCTCGACGTTTGCGAGATT
GGTGAGCTTGTCGGCTACACCGGCCAGGTCAAGCAGGTCAAGGTTCTCGGCGTCATGGCCCTGATTGACGAGGAG
GAGACCGACTGGAAGATCATTGTCATCGACGTCAACGACCCTCTTGCTCCCAAGCTCAACGACATCGAGGATGTC
GAGCGCCAGCTTCCTGGTCTCATGCGCGCCACCAACGAGTGGTTCCGCATTTACAAGATCCCCGACGGAAAGCCC
GAGAACCAGTTCGCCTTCTCCGGCGAGTGCAAGAACAAGAAGTACGCCGAGGATGTCATCCGCGAGTGCTCCGAT
GCCTGGGAGAAGCTTGTCACTGGCAAGACCCCCCGTGGCGATATCAGCCTTGCCAACACCACCGTCGAGAACTCT
CCCGACCGTGTTGACCAGGCCCAGCTCGCTGCCATCCCCCGCAACGAGAACCTCCCCCCTGCTCCCATTGATGGA
AGCATTGACAAGTGGTTCTTCATCTCAGGTGCCGCAGTATAA
Gene >Pro_DTO377G3_2|g6792.t1
ATGACTTACTCCATCCGCAAGATCGGTACCCCATACACTCTCGAGCACCGCGTGTTCGTTGAGAAGGATGGCGTC
CCTGTTTCTCCCTTCCACGACATTCCTCTCTACGCCAACGAGCAGCAAACCATCCTGAACATGGTCGTTGAGATC
CCCCGCTGGACCAACGCCAAGCAGGAGGTACGACACACAGTCCCGCAATTGACCTCAGCTTTATACTGATCGCAT
CAACACAGATCTCCAAGGATGATTTCCTCAACCCCATCAAGCAGGACACCAAGAAGGGCAAGCTCCGCTTCGTCC
GCAACTGCTTCCCTCACAAGGGTTACCTCTGGAACTACGGTGCCTTCCCTCGCGTAAGCTTCGAACCTTCCTCCC
ACACCCGTGGGTAAGAAGAGGGGCAGAAAACTGACGTTATCTACCAGACTTGGGAGGACCCCAACTCCATCCACC
CCGAGACCAAGGCCAAGGGTGACAACGATCCCCTCGACGTTTGCGAGATTGGTGAGCTTGTCGGCTACACCGGCC
AGGTCAAGCAGGTCAAGGTTCTCGGCGTCATGGCCCTGATTGACGAGGAGGAGACCGACTGGAAGATCATTGTCA
TCGACGTCAACGACCCTCTTGCTCCCAAGCTCAACGACATCGAGGATGTCGAGCGCCAGCTTCCTGGTCTCATGC
GCGCCACCAACGAGTGGTTCCGCATTTACAAGATCCCCGACGGAAAGCCCGAGAACCAGTTCGCCTTCTCCGGCG
AGTGCAAGAACAAGAAGTACGCCGAGGATGTCATCCGCGAGTGCTCCGATGCCTGGGAGAAGCTTGTCACTGGCA
AGACCCCCCGTGGCGATATCAGCCTGTGAGTTCTACATGCATGTATCCTATTTTGAGGATTTGAAGCTAACCTGC
ACAGTGCCAACACCACCGTCGAGAACTCTCCCGACCGTGTTGACCAGGCCCAGCTCGCTGCCATCCCCCGCAACG
AGAACCTCCCCCCTGCTCCCATTGATGGAAGCATTGACAAGTGGTTCTTCATCTCAGGTGCCGCAGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail