Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6787.t1
Gene name
Locationscaffold_19:36402..37592
Strand+
Gene length (bp)1190
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase 4.9E-30 30 132
PF13242 Hydrolase_like HAD-hyrolase-like 5.4E-13 233 306
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.5E-10 28 269

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 46.42 25.08 67.77
5d_25C Five days - 25 degrees Celsius 52.69 29.18 76.21
7d_25C Seven days - 25 degrees Celsius 51.92 28.62 75.22
10d_25C Ten days - 25 degrees Celsius 37.50 19.18 55.81
7d_15C Seven days - 15 degrees Celsius 48.91 26.66 71.17
7d_30C Seven days - 30 degrees Celsius 46.08 24.83 67.34

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.703919 no
3d_25C 7d_25C 0.740103 no
3d_25C 7d_15C 0.889001 no
3d_25C 7d_30C 0.986662 no
3d_25C 10d_25C 0.485456 no
5d_25C 7d_25C 0.971859 no
5d_25C 7d_15C 0.835055 no
5d_25C 7d_30C 0.684858 no
5d_25C 10d_25C 0.217002 no
7d_25C 7d_15C 0.869157 no
7d_25C 7d_30C 0.721475 no
7d_25C 10d_25C 0.235613 no
7d_15C 7d_30C 0.873977 no
7d_15C 10d_25C 0.352031 no
7d_30C 10d_25C 0.503973 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6787.t1
MAQESSQVAPRYLTGDKAGLQEFLARFDVFLFDCDGVLWSGDHLFPGTVETLELLRKNGKQIVFVTNNSTKSRAD
YRKKLEGLGIPSTVEEIFSSSYSASIYISRILQLPENKRKVYVIGETGIEQELRSENVPFIGGTDPAYRRDVTSE
DYNKIAAGDESVLDPEVGVVLVGLDFHVNYLKIALAYHYIKRGAIFLATNVDSTLPHSGSFFPGAGSMSAPLIMM
LNQEPVALGKPSQAMMDSIEGKFKFDRSRTCMVGDRVNTDIRFGLEGKLGGTLGVLTGVSSEEEFVSGDVRPHAY
LDALSDLLASEGA*
Coding >Pro_DTO377G3_2|g6787.t1
ATGGCGCAAGAATCCTCGCAAGTCGCGCCCCGCTACCTGACCGGCGATAAGGCCGGCCTCCAGGAATTCCTAGCC
AGATTCGATGTATTCCTCTTCGACTGTGATGGCGTCTTATGGTCCGGCGACCACCTCTTCCCCGGAACAGTAGAG
ACACTGGAGCTTCTCCGAAAGAATGGGAAGCAAATCGTTTTCGTGACGAATAACAGCACCAAGTCGCGCGCAGAC
TACCGCAAGAAACTCGAAGGCTTAGGGATCCCTAGTACAGTGGAAGAGATCTTCTCCTCCTCATACAGCGCCTCT
ATATACATTTCGCGCATCCTCCAACTCCCCGAAAACAAGCGCAAAGTCTACGTGATCGGCGAGACAGGCATCGAG
CAAGAGCTCCGCTCCGAGAATGTCCCTTTCATCGGCGGCACAGACCCTGCCTACCGCCGCGACGTCACGTCAGAG
GACTACAACAAGATCGCGGCGGGCGATGAGTCCGTCCTAGACCCGGAGGTTGGTGTCGTGCTTGTCGGTCTCGAC
TTCCACGTGAATTACCTCAAGATCGCGCTGGCATACCACTACATCAAGCGCGGAGCGATCTTCCTCGCCACGAAC
GTCGACTCCACCCTTCCGCACTCGGGGTCTTTTTTCCCTGGCGCTGGCTCCATGAGCGCGCCGCTGATAATGATG
CTGAATCAGGAACCGGTCGCTCTCGGAAAACCCAGTCAGGCTATGATGGATTCCATCGAGGGTAAGTTCAAGTTT
GATCGTAGCCGGACTTGCATGGTTGGTGACCGTGTGAATACCGATATTCGCTTTGGACTTGAGGGTAAACTTGGC
GGTACGCTGGGTGTCTTGACTGGTGTCTCTTCTGAGGAGGAGTTCGTGTCTGGGGATGTCAGGCCTCATGCTTAC
TTGGATGCGCTTTCTGATCTACTAGCCTCGGAGGGGGCCTGA
Transcript >Pro_DTO377G3_2|g6787.t1
ATGGCGCAAGAATCCTCGCAAGTCGCGCCCCGCTACCTGACCGGCGATAAGGCCGGCCTCCAGGAATTCCTAGCC
AGATTCGATGTATTCCTCTTCGACTGTGATGGCGTCTTATGGTCCGGCGACCACCTCTTCCCCGGAACAGTAGAG
ACACTGGAGCTTCTCCGAAAGAATGGGAAGCAAATCGTTTTCGTGACGAATAACAGCACCAAGTCGCGCGCAGAC
TACCGCAAGAAACTCGAAGGCTTAGGGATCCCTAGTACAGTGGAAGAGATCTTCTCCTCCTCATACAGCGCCTCT
ATATACATTTCGCGCATCCTCCAACTCCCCGAAAACAAGCGCAAAGTCTACGTGATCGGCGAGACAGGCATCGAG
CAAGAGCTCCGCTCCGAGAATGTCCCTTTCATCGGCGGCACAGACCCTGCCTACCGCCGCGACGTCACGTCAGAG
GACTACAACAAGATCGCGGCGGGCGATGAGTCCGTCCTAGACCCGGAGGTTGGTGTCGTGCTTGTCGGTCTCGAC
TTCCACGTGAATTACCTCAAGATCGCGCTGGCATACCACTACATCAAGCGCGGAGCGATCTTCCTCGCCACGAAC
GTCGACTCCACCCTTCCGCACTCGGGGTCTTTTTTCCCTGGCGCTGGCTCCATGAGCGCGCCGCTGATAATGATG
CTGAATCAGGAACCGGTCGCTCTCGGAAAACCCAGTCAGGCTATGATGGATTCCATCGAGGGTAAGTTCAAGTTT
GATCGTAGCCGGACTTGCATGGTTGGTGACCGTGTGAATACCGATATTCGCTTTGGACTTGAGGGTAAACTTGGC
GGTACGCTGGGTGTCTTGACTGGTGTCTCTTCTGAGGAGGAGTTCGTGTCTGGGGATGTCAGGCCTCATGCTTAC
TTGGATGCGCTTTCTGATCTACTAGCCTCGGAGGGGGCCTGA
Gene >Pro_DTO377G3_2|g6787.t1
ATGGCGCAAGAATCCTCGCAAGTCGCGCCCCGCTACCTGACCGGCGATAAGGCCGGCCTCCAGGAATTCCTAGCC
AGATTCGATGTGAGCACACGTTTTGGATCTACCGATGTACTAGAGAGTCCTGTTACTAACCAGATTCTGTACAGG
TATTCCTCTTCGACTGTGATGGTCTGTCCCCTCTGTATCGGCCGAAGCTCCCCGCAGCGCTGAACGCGTCGCAAC
AACCGCTGAGACAATAATATTTAGGCGTCTTATGGTCCGGCGACCACCTCTTCCCCGGAACAGTAGAGACACTGG
AGCTTCTCCGAAAGAATGGTGCGCATTAAATACCAAGTGCGCAAACAGAGGTTAATAATCCCCAGGGAAGCAAAT
CGTTTTCGTGACGAATAACAGCACCAAGTCGCGCGCAGACTACCGCAAGAAACTCGAAGGCTTAGGGATCCCTAG
TACAGTGGTCAGTGATACCACCGATTAATCACCTCACCCAGTGGCAGCGACTCACAACCAAACAGGAAGAGATCT
TCTCCTCCTCATACAGCGCCTCTATATACATTTCGCGCATCCTCCAACTCCCCGAAAACAAGCGCAAAGTCTACG
TGATCGGCGAGACAGGCATCGAGCAAGAGCTCCGCTCCGAGAATGTCCCTTTCATCGGCGGCACAGACCCTGCCT
ACCGCCGCGACGTCACGTCAGAGGACTACAACAAGATCGCGGCGGGCGATGAGTCCGTCCTAGACCCGGAGGTTG
GTGTCGTGCTTGTCGGTCTCGACTTCCACGTGAATTACCTCAAGATCGCGCTGGCATACCACTACATCAAGCGCG
GAGCGATCTTCCTCGCCACGAACGTCGACTCCACCCTTCCGCACTCGGGGTCTTTTTTCCCTGGCGCTGGCTCCA
TGAGCGCGCCGCTGATAATGATGCTGAATCAGGAACCGGTCGCTCTCGGAAAACCCAGTCAGGCTATGATGGATT
CCATCGAGGGTAAGTTCAAGTTTGATCGTAGCCGGACTTGCATGGTTGGTGACCGTGTGAATACCGATATTCGCT
TTGGACTTGAGGGTAAACTTGGCGGTACGCTGGGTGTCTTGACTGGTGTCTCTTCTGAGGAGGAGTTCGTGTCTG
GGGATGTCAGGCCTCATGCTTACTTGGATGCGCTTTCTGATCTACTAGCCTCGGAGGGGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail