Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6785.t1
Gene name
Locationscaffold_19:29819..30908
Strand+
Gene length (bp)1089
Transcript length (bp)759
Coding sequence length (bp)759
Protein length (aa) 253

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 1.3E-08 26 93

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 16.21 6.28 26.14
5d_25C Five days - 25 degrees Celsius 17.10 6.80 27.39
7d_25C Seven days - 25 degrees Celsius 17.85 7.15 28.56
10d_25C Ten days - 25 degrees Celsius 15.54 6.00 25.08
7d_15C Seven days - 15 degrees Celsius 12.81 4.56 21.06
7d_30C Seven days - 30 degrees Celsius 29.47 13.85 45.10

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.916940 no
3d_25C 7d_25C 0.844545 no
3d_25C 7d_15C 0.575705 no
3d_25C 7d_30C 0.054965 no
3d_25C 10d_25C 0.936764 no
5d_25C 7d_25C 0.936054 no
5d_25C 7d_15C 0.472554 no
5d_25C 7d_30C 0.086529 no
5d_25C 10d_25C 0.847070 no
7d_25C 7d_15C 0.387324 no
7d_25C 7d_30C 0.115508 no
7d_25C 10d_25C 0.756518 no
7d_15C 7d_30C 0.008133 yes
7d_15C 10d_25C 0.659868 no
7d_30C 10d_25C 0.035449 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6785.t1
MYQEAIARLRNYIPPPTTYYSVPVSRRAAVLLLLFADAKGDLRVVVTIRAKTLSSYAGDAALPGGRAENTESAFQ
TARREACEEIGLPDIQEREKLPPPFSVEHLCEFPANLARTEVVVRPCVALLHSYDAGLGLNSNPEVSLIPILDTR
EVEVVFTAPFQDFLRGHGENGEDWYRGSWGMWHNSQWRMHQFFVPRADQVYRIFGMTARIIVDAARVAYAQEPEF
EHNSHFGDEAMIADLRQLGRLGEKAKV*
Coding >Pro_DTO377G3_2|g6785.t1
ATGTATCAGGAGGCAATCGCCAGACTTCGAAATTACATCCCTCCGCCAACAACGTACTACTCGGTCCCGGTAAGC
AGACGGGCGGCAGTGCTGCTACTGCTCTTCGCCGACGCCAAGGGCGATCTTAGGGTGGTGGTTACGATCCGGGCT
AAGACACTAAGTTCGTACGCGGGAGATGCTGCATTGCCAGGTGGCCGAGCAGAAAATACAGAATCCGCCTTCCAA
ACGGCGCGGCGCGAGGCATGTGAGGAGATCGGCCTCCCCGACATTCAGGAAAGGGAAAAGCTTCCACCCCCGTTC
AGCGTGGAGCATCTCTGCGAGTTCCCGGCAAATCTTGCCCGAACGGAGGTGGTGGTTCGTCCCTGCGTTGCGCTC
CTCCACAGTTATGATGCGGGCTTGGGGCTGAATTCTAATCCTGAGGTGTCACTTATTCCTATTCTGGACACGAGA
GAGGTTGAGGTTGTTTTTACGGCGCCGTTCCAGGACTTTCTGCGCGGACATGGAGAGAATGGGGAGGACTGGTAT
CGTGGGTCTTGGGGGATGTGGCATAATTCGCAATGGAGAATGCATCAGTTCTTTGTTCCCAGAGCAGACCAAGTC
TACCGTATCTTTGGCATGACTGCACGCATTATCGTCGACGCAGCCCGGGTCGCATACGCGCAGGAACCGGAATTC
GAACATAACAGTCATTTTGGCGACGAGGCCATGATCGCCGACCTGCGCCAGTTGGGCCGGTTAGGTGAAAAGGCC
AAAGTTTAG
Transcript >Pro_DTO377G3_2|g6785.t1
ATGTATCAGGAGGCAATCGCCAGACTTCGAAATTACATCCCTCCGCCAACAACGTACTACTCGGTCCCGGTAAGC
AGACGGGCGGCAGTGCTGCTACTGCTCTTCGCCGACGCCAAGGGCGATCTTAGGGTGGTGGTTACGATCCGGGCT
AAGACACTAAGTTCGTACGCGGGAGATGCTGCATTGCCAGGTGGCCGAGCAGAAAATACAGAATCCGCCTTCCAA
ACGGCGCGGCGCGAGGCATGTGAGGAGATCGGCCTCCCCGACATTCAGGAAAGGGAAAAGCTTCCACCCCCGTTC
AGCGTGGAGCATCTCTGCGAGTTCCCGGCAAATCTTGCCCGAACGGAGGTGGTGGTTCGTCCCTGCGTTGCGCTC
CTCCACAGTTATGATGCGGGCTTGGGGCTGAATTCTAATCCTGAGGTGTCACTTATTCCTATTCTGGACACGAGA
GAGGTTGAGGTTGTTTTTACGGCGCCGTTCCAGGACTTTCTGCGCGGACATGGAGAGAATGGGGAGGACTGGTAT
CGTGGGTCTTGGGGGATGTGGCATAATTCGCAATGGAGAATGCATCAGTTCTTTGTTCCCAGAGCAGACCAAGTC
TACCGTATCTTTGGCATGACTGCACGCATTATCGTCGACGCAGCCCGGGTCGCATACGCGCAGGAACCGGAATTC
GAACATAACAGTCATTTTGGCGACGAGGCCATGATCGCCGACCTGCGCCAGTTGGGCCGGTTAGGTGAAAAGGCC
AAAGTTTAG
Gene >Pro_DTO377G3_2|g6785.t1
ATGTATCAGGAGGCAATCGCCAGACTTCGAAATTACATCCCTCCGCCAACAACGTACTACTCGGTCCCGGTAAGC
AGACGGGCGGCAGTGCTGCTACTGCTCTTCGCCGACGCCAAGGGCGATCTTAGGGTGGTGGTTACGATCCGGGCT
AAGACACTAAGTTCGTGTGAGTGACCAGAACTTAGAAAATACGTGGATCAGCCCTGTTCCCAGGCTGCATGACAT
GGGTTGGTTGTTCGGGACTAGGCTAATGATATTCGGGTCTACGGAGTAGACGCGGGAGATGCTGCATTGCCAGGT
GGTAAGTTTGACAGCTCCAGACTCTGCAAGGCAAAGGCAAAAGAGAAAGGAATAAAAAAAAGAATAAATTCCTCG
CTTAAAATAAACTAACCCCTTCTTCACCGGAGTAGGCCGAGCAGAAAATACAGAATCCGCCTTCCAAACGGCGCG
GCGCGAGGCATGTGAGGAGATCGGCCTCCCCGACATTCAGGAAAGGGAAAAGCTTCCACCCCCGTTCAGCGTGGA
GCATCTCTGCGAGTTCCCGGCAAATCTTGCCCGAACGGAGGTGGTGGTTCGTCCCTGCGTTGCGCTCCTCCACAG
TTATGATGCGGGCTTGGGGCTGAATTCTAATCCTGAGGTGTCACTTATTCCTATTCTGGACACGAGAGAGGTTGA
GGTTGTTTTTACGGCGCCGTTCCAGGACTTTCTGCGCGGACATGGAGAGAATGGGGAGGACTGGTATCGTGGGTC
TTGGGGGATGTGGCATAATTCGCAATGGAGAAGTAAGTGGCCTCCCCCTATGTTGATGTATGTGTTGTGTCTGTG
TTGTGTGTGGGATTGCCAAGTGGAGGACGTCCCAAATAGGAAATAGCCTGGAGACTAACTACGCCACTAGTGCAT
CAGTTCTTTGTTCCCAGAGCAGACCAAGTCTACCGTATCTTTGGCATGACTGCACGCATTATCGTCGACGCAGCC
CGGGTCGCATACGCGCAGGAACCGGAATTCGAACATAACAGTCATTTTGGCGACGAGGCCATGATCGCCGACCTG
CGCCAGTTGGGCCGGTTAGGTGAAAAGGCCAAAGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail