Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6783.t1
Gene name
Locationscaffold_19:22756..26652
Strand+
Gene length (bp)3896
Transcript length (bp)3159
Coding sequence length (bp)3159
Protein length (aa) 1053

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11001 DUF2841 Protein of unknown function (DUF2841) 3.4E-47 167 301
PF10998 DUF2838 Protein of unknown function (DUF2838) 6.7E-42 700 810

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 706 728 22
2 749 771 22
3 776 798 22
4 811 833 22
5 856 878 22
6 921 943 22
7 948 970 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 29.22 17.67 40.76
5d_25C Five days - 25 degrees Celsius 36.41 22.10 50.72
7d_25C Seven days - 25 degrees Celsius 45.85 26.77 64.93
10d_25C Ten days - 25 degrees Celsius 31.95 19.23 44.68
7d_15C Seven days - 15 degrees Celsius 27.06 14.72 39.41
7d_30C Seven days - 30 degrees Celsius 53.99 31.79 76.20

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.360842 no
3d_25C 7d_25C 0.038585 yes
3d_25C 7d_15C 0.816287 no
3d_25C 7d_30C 0.002297 yes
3d_25C 10d_25C 0.763101 no
5d_25C 7d_25C 0.357095 no
5d_25C 7d_15C 0.238197 no
5d_25C 7d_30C 0.065652 no
5d_25C 10d_25C 0.643655 no
7d_25C 7d_15C 0.023673 yes
7d_25C 7d_30C 0.546060 no
7d_25C 10d_25C 0.112725 no
7d_15C 7d_30C 0.002297 yes
7d_15C 10d_25C 0.565384 no
7d_30C 10d_25C 0.010411 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6783.t1
MDMNRYPVPEEVLERRHSDTCIPHQHMNMPITPKQPHTEYTHPHFAMIYLDHNGQWQLQASPSIAGCEGAIFTQD
VTDRFIEMTGQTPQTSPQFPNPTQAPHSPWDEQPASGWAPPQARQAEMIPFQWSSQQSRKKSRRAGGTPKSRPKS
TSPPPVAPAPGRTVLRVGNRALLRRYYEKAFEDFQQLNCRAIAKSYIKLVEPRKQVHYPYNGRRVIAGVSQRVDP
EFTKPAWWPAGVLHKEPDHLLKPDRLRLLVHILCELKDSHGVTTDKLREAGQDVRRQITPAHRLQVLDEIYFVRQ
MEEQYLDGEIDASTLIQITQTHLPEAIFPDDDLSSRAHAAPVTAPSIEAEHNMHDARDNPVISTLEDDDPKLHHS
HSLPLSPTTSESSGPHSPTGSFGYPIAIAPSVHVIPPLESPNVTKSIHPDPSYLSGYYSQQFVSDKAPGFWPHAN
TASHSSIQPPLTSPAHVNSSPSRWLLTPYIAVSVPCASKPAVVYFLDRQPQSAIRALRLQHTRDLPISRPYPNTR
DGPTILCFQQQFLMESTGSRRKSDTMSAEPPVSTPVVEDVSSDDSDNDESDSPAITPGTLSRNGSFSNSSSYLED
WESFPPLDKLTIFDLLDNIHLSQRLETWQQTLAAQREKVRKQREKLRLSSLNAKDRVMGEWKRHAPTAEEKLEKY
RARMKHGVERLGKRWSQTATVTLREKMSFIAGVLNIFISGYLIGACPEYFYYWFSGQLAFFMPIRYFTYHAKGYH
YFLADLCYFVNLLCMLSIWVFPNSKRLFISTFCLTFGNNAVAIAMWRNSMVFHSMDKVVSLFIHIMPPVTLHCIV
HLTPVAILKERFPAVYDIKFSKPGDPEHYGLGAMILWSTAPYVVWQLMYHFLITVRRRDQIAAGRPTSFTWLRKS
YSKAWIGRFVLSLPETLQEPCFMVIQYAYALSTMLPCPIWFWYKWASGLFMSALFVWSIHNGATYYIDVFGRRFQ
KELEQLRTDMARWQNSPEGSTSPILIPEPSPLSEAINAHSEEKRSSVDRIPLLETADVSSTDIPEKDNKDSVVRE
RI*
Coding >Pro_DTO377G3_2|g6783.t1
ATGGATATGAATCGATATCCAGTTCCCGAAGAGGTCTTGGAGAGAAGACACTCTGATACGTGCATCCCACACCAG
CATATGAACATGCCGATCACTCCTAAACAGCCCCATACCGAATATACACACCCACACTTCGCCATGATATACCTC
GACCACAACGGTCAATGGCAACTACAAGCCTCGCCCTCAATTGCAGGCTGCGAAGGCGCCATCTTCACTCAAGAT
GTTACAGACCGATTCATAGAAATGACTGGCCAGACGCCCCAAACCAGTCCGCAGTTCCCAAACCCGACCCAAGCA
CCCCACTCCCCTTGGGACGAGCAACCTGCTTCGGGATGGGCCCCGCCTCAGGCGCGACAGGCCGAGATGATCCCG
TTCCAATGGTCATCACAGCAAAGCCGAAAAAAGTCGAGGCGTGCCGGCGGTACGCCCAAGTCTCGACCGAAATCT
ACCTCGCCGCCGCCTGTCGCTCCGGCTCCCGGGCGGACGGTCCTTCGTGTCGGGAACCGGGCGCTGCTGCGACGG
TACTATGAGAAGGCATTTGAGGATTTCCAGCAGCTCAACTGCCGGGCGATTGCGAAATCCTATATTAAGCTTGTC
GAGCCGAGGAAGCAGGTCCACTACCCGTATAACGGGCGCAGGGTGATTGCCGGTGTCTCGCAGCGTGTTGACCCG
GAGTTCACGAAGCCTGCGTGGTGGCCTGCTGGTGTCTTGCACAAAGAGCCTGATCATCTGCTCAAACCTGATCGT
CTGCGACTTCTGGTTCATATCCTCTGTGAACTAAAGGATAGCCACGGAGTCACAACGGATAAGCTGCGAGAAGCT
GGCCAAGACGTCAGACGGCAGATCACACCTGCCCACCGGCTGCAGGTTCTCGACGAGATCTACTTTGTGCGCCAA
ATGGAAGAACAATATCTGGATGGTGAAATCGACGCCAGCACCTTGATTCAGATAACACAGACACATCTACCCGAA
GCAATCTTCCCAGACGATGACCTATCATCTCGTGCACACGCAGCACCCGTAACAGCCCCTTCCATCGAGGCCGAA
CATAACATGCACGACGCCCGCGACAACCCTGTTATCTCCACGCTGGAAGACGATGACCCAAAGCTGCACCACTCG
CATAGTCTGCCCCTATCACCCACTACTAGCGAGTCCAGTGGTCCACACAGCCCAACTGGCAGTTTCGGCTACCCA
ATAGCCATAGCACCCTCCGTGCATGTAATACCCCCTCTCGAGTCCCCCAATGTCACAAAGTCTATACATCCAGAC
CCGAGTTATCTGTCGGGGTACTACTCGCAGCAATTCGTGTCTGATAAAGCGCCTGGGTTTTGGCCACATGCCAAT
ACTGCCTCGCACTCCTCCATCCAACCACCACTCACATCGCCAGCACACGTCAATTCCTCACCTTCTCGCTGGCTC
TTGACTCCCTACATCGCCGTTTCCGTGCCATGCGCCAGTAAGCCCGCAGTTGTTTACTTCTTGGATCGCCAACCA
CAGTCCGCCATCCGCGCCCTCCGACTCCAACACACGCGTGATCTACCGATAAGTCGACCGTATCCCAACACCCGG
GACGGACCGACAATACTCTGCTTCCAGCAACAGTTTCTAATGGAAAGCACCGGCTCGAGGAGAAAATCCGATACC
ATGTCGGCCGAGCCTCCGGTCTCCACGCCAGTCGTGGAGGATGTGTCTTCAGATGACTCCGACAACGATGAATCC
GACTCTCCTGCCATAACCCCAGGAACCCTGTCGCGCAACGGCTCCTTCTCAAACAGCAGCTCGTACCTAGAAGAC
TGGGAGTCATTTCCACCGCTGGACAAGCTGACTATTTTCGACCTCCTCGACAACATCCACCTCTCACAGCGTCTG
GAGACTTGGCAGCAGACCCTCGCCGCGCAAAGGGAGAAGGTGCGCAAGCAGCGGGAGAAGCTGAGGTTGTCGTCC
TTGAATGCCAAGGACCGTGTTATGGGTGAATGGAAGCGCCATGCACCGACCGCCGAGGAGAAGCTGGAGAAATAT
CGTGCTCGGATGAAGCATGGCGTTGAGCGTCTCGGCAAGCGGTGGAGCCAGACGGCGACTGTCACCCTCCGGGAG
AAGATGTCGTTTATTGCTGGTGTGCTCAATATCTTCATCAGCGGCTACCTGATCGGTGCTTGCCCGGAGTACTTT
TACTACTGGTTTAGCGGCCAGCTGGCTTTTTTCATGCCCATCCGCTACTTTACATACCATGCTAAAGGCTACCAC
TACTTCTTGGCCGATCTCTGCTACTTTGTCAATTTGCTCTGCATGCTGAGTATTTGGGTCTTCCCGAACTCGAAA
CGGCTTTTCATTAGCACGTTCTGCTTGACTTTCGGAAACAATGCGGTTGCAATCGCCATGTGGCGGAACTCGATG
GTGTTCCACAGTATGGACAAGGTCGTCAGTCTCTTCATCCATATTATGCCACCCGTGACTCTGCACTGCATCGTA
CACCTGACTCCGGTTGCGATACTCAAGGAACGCTTCCCTGCTGTCTACGACATCAAGTTCAGTAAGCCCGGGGAC
CCAGAGCATTATGGTCTTGGTGCCATGATCCTCTGGTCCACGGCCCCCTATGTGGTGTGGCAGCTCATGTACCAC
TTCCTGATTACCGTGCGCCGCCGCGACCAAATCGCAGCGGGTCGTCCGACCAGCTTCACCTGGCTGCGCAAGTCA
TACTCCAAAGCGTGGATTGGGCGGTTTGTGCTGAGTCTACCCGAGACGCTGCAAGAGCCATGCTTTATGGTGATC
CAGTACGCGTACGCTTTGTCCACCATGCTCCCCTGTCCGATCTGGTTCTGGTACAAATGGGCCAGCGGTCTGTTC
ATGTCTGCGCTATTCGTCTGGAGCATCCACAATGGAGCGACCTACTACATCGACGTCTTTGGAAGGCGCTTCCAA
AAGGAGCTGGAACAGCTTAGGACAGATATGGCTCGTTGGCAGAACTCTCCCGAAGGATCAACTAGTCCTATCCTT
ATCCCTGAGCCCAGCCCTCTCAGTGAAGCCATCAATGCACACAGCGAGGAGAAGCGATCTAGCGTTGATCGAATC
CCTTTGTTGGAAACTGCCGATGTCTCCTCTACTGATATACCGGAGAAAGACAACAAGGATTCTGTTGTTCGAGAG
CGAATTTGA
Transcript >Pro_DTO377G3_2|g6783.t1
ATGGATATGAATCGATATCCAGTTCCCGAAGAGGTCTTGGAGAGAAGACACTCTGATACGTGCATCCCACACCAG
CATATGAACATGCCGATCACTCCTAAACAGCCCCATACCGAATATACACACCCACACTTCGCCATGATATACCTC
GACCACAACGGTCAATGGCAACTACAAGCCTCGCCCTCAATTGCAGGCTGCGAAGGCGCCATCTTCACTCAAGAT
GTTACAGACCGATTCATAGAAATGACTGGCCAGACGCCCCAAACCAGTCCGCAGTTCCCAAACCCGACCCAAGCA
CCCCACTCCCCTTGGGACGAGCAACCTGCTTCGGGATGGGCCCCGCCTCAGGCGCGACAGGCCGAGATGATCCCG
TTCCAATGGTCATCACAGCAAAGCCGAAAAAAGTCGAGGCGTGCCGGCGGTACGCCCAAGTCTCGACCGAAATCT
ACCTCGCCGCCGCCTGTCGCTCCGGCTCCCGGGCGGACGGTCCTTCGTGTCGGGAACCGGGCGCTGCTGCGACGG
TACTATGAGAAGGCATTTGAGGATTTCCAGCAGCTCAACTGCCGGGCGATTGCGAAATCCTATATTAAGCTTGTC
GAGCCGAGGAAGCAGGTCCACTACCCGTATAACGGGCGCAGGGTGATTGCCGGTGTCTCGCAGCGTGTTGACCCG
GAGTTCACGAAGCCTGCGTGGTGGCCTGCTGGTGTCTTGCACAAAGAGCCTGATCATCTGCTCAAACCTGATCGT
CTGCGACTTCTGGTTCATATCCTCTGTGAACTAAAGGATAGCCACGGAGTCACAACGGATAAGCTGCGAGAAGCT
GGCCAAGACGTCAGACGGCAGATCACACCTGCCCACCGGCTGCAGGTTCTCGACGAGATCTACTTTGTGCGCCAA
ATGGAAGAACAATATCTGGATGGTGAAATCGACGCCAGCACCTTGATTCAGATAACACAGACACATCTACCCGAA
GCAATCTTCCCAGACGATGACCTATCATCTCGTGCACACGCAGCACCCGTAACAGCCCCTTCCATCGAGGCCGAA
CATAACATGCACGACGCCCGCGACAACCCTGTTATCTCCACGCTGGAAGACGATGACCCAAAGCTGCACCACTCG
CATAGTCTGCCCCTATCACCCACTACTAGCGAGTCCAGTGGTCCACACAGCCCAACTGGCAGTTTCGGCTACCCA
ATAGCCATAGCACCCTCCGTGCATGTAATACCCCCTCTCGAGTCCCCCAATGTCACAAAGTCTATACATCCAGAC
CCGAGTTATCTGTCGGGGTACTACTCGCAGCAATTCGTGTCTGATAAAGCGCCTGGGTTTTGGCCACATGCCAAT
ACTGCCTCGCACTCCTCCATCCAACCACCACTCACATCGCCAGCACACGTCAATTCCTCACCTTCTCGCTGGCTC
TTGACTCCCTACATCGCCGTTTCCGTGCCATGCGCCAGTAAGCCCGCAGTTGTTTACTTCTTGGATCGCCAACCA
CAGTCCGCCATCCGCGCCCTCCGACTCCAACACACGCGTGATCTACCGATAAGTCGACCGTATCCCAACACCCGG
GACGGACCGACAATACTCTGCTTCCAGCAACAGTTTCTAATGGAAAGCACCGGCTCGAGGAGAAAATCCGATACC
ATGTCGGCCGAGCCTCCGGTCTCCACGCCAGTCGTGGAGGATGTGTCTTCAGATGACTCCGACAACGATGAATCC
GACTCTCCTGCCATAACCCCAGGAACCCTGTCGCGCAACGGCTCCTTCTCAAACAGCAGCTCGTACCTAGAAGAC
TGGGAGTCATTTCCACCGCTGGACAAGCTGACTATTTTCGACCTCCTCGACAACATCCACCTCTCACAGCGTCTG
GAGACTTGGCAGCAGACCCTCGCCGCGCAAAGGGAGAAGGTGCGCAAGCAGCGGGAGAAGCTGAGGTTGTCGTCC
TTGAATGCCAAGGACCGTGTTATGGGTGAATGGAAGCGCCATGCACCGACCGCCGAGGAGAAGCTGGAGAAATAT
CGTGCTCGGATGAAGCATGGCGTTGAGCGTCTCGGCAAGCGGTGGAGCCAGACGGCGACTGTCACCCTCCGGGAG
AAGATGTCGTTTATTGCTGGTGTGCTCAATATCTTCATCAGCGGCTACCTGATCGGTGCTTGCCCGGAGTACTTT
TACTACTGGTTTAGCGGCCAGCTGGCTTTTTTCATGCCCATCCGCTACTTTACATACCATGCTAAAGGCTACCAC
TACTTCTTGGCCGATCTCTGCTACTTTGTCAATTTGCTCTGCATGCTGAGTATTTGGGTCTTCCCGAACTCGAAA
CGGCTTTTCATTAGCACGTTCTGCTTGACTTTCGGAAACAATGCGGTTGCAATCGCCATGTGGCGGAACTCGATG
GTGTTCCACAGTATGGACAAGGTCGTCAGTCTCTTCATCCATATTATGCCACCCGTGACTCTGCACTGCATCGTA
CACCTGACTCCGGTTGCGATACTCAAGGAACGCTTCCCTGCTGTCTACGACATCAAGTTCAGTAAGCCCGGGGAC
CCAGAGCATTATGGTCTTGGTGCCATGATCCTCTGGTCCACGGCCCCCTATGTGGTGTGGCAGCTCATGTACCAC
TTCCTGATTACCGTGCGCCGCCGCGACCAAATCGCAGCGGGTCGTCCGACCAGCTTCACCTGGCTGCGCAAGTCA
TACTCCAAAGCGTGGATTGGGCGGTTTGTGCTGAGTCTACCCGAGACGCTGCAAGAGCCATGCTTTATGGTGATC
CAGTACGCGTACGCTTTGTCCACCATGCTCCCCTGTCCGATCTGGTTCTGGTACAAATGGGCCAGCGGTCTGTTC
ATGTCTGCGCTATTCGTCTGGAGCATCCACAATGGAGCGACCTACTACATCGACGTCTTTGGAAGGCGCTTCCAA
AAGGAGCTGGAACAGCTTAGGACAGATATGGCTCGTTGGCAGAACTCTCCCGAAGGATCAACTAGTCCTATCCTT
ATCCCTGAGCCCAGCCCTCTCAGTGAAGCCATCAATGCACACAGCGAGGAGAAGCGATCTAGCGTTGATCGAATC
CCTTTGTTGGAAACTGCCGATGTCTCCTCTACTGATATACCGGAGAAAGACAACAAGGATTCTGTTGTTCGAGAG
CGAATTTGA
Gene >Pro_DTO377G3_2|g6783.t1
ATGGATATGAATCGATATCCAGTTCCCGAAGAGGTCTTGGAGAGAAGACACTCTGATACGTGCATCCCACACCAG
CATATGAACATGGTAATAGAACTATTGCAAACCAAGGCACATCAGTGGGCTAACAACCAATAGCCGATCACTCCT
AAACAGCCCCATACCGAATATACACACCCACACTTCGCCATGATATACCTCGACCACAACGGTCAATGGCAACTA
CAAGCCTCGCCCTCAATTGCAGGCTGCGAAGGCGCCATCTTCACTCAAGATGTTACAGACCGATTCATAGAAATG
ACTGGCCAGACGCCCCAAACCAGTCCGCAGTTCCCAAGTGAGTCAGATTCCATCCAAGTTCCAGAACGACGCTGA
CATCCTCTCCTTGCAGACCCGACCCAAGCACCCCACTCCCCTTGGGACGAGCAACCTGCTTCGGGATGGGCCCCG
CCTCAGGCGCGACAGGCCGAGATGATCCCGTTCCAATGGTCATCACAGCAAAGCCGAAAAAAGTCGAGGCGTGCC
GGCGGTACGCCCAAGTCTCGACCGAAATCTACCTCGCCGCCGCCTGTCGCTCCGGCTCCCGGGCGGACGGTCCTT
CGTGTCGGGAACCGGGCGCTGCTGCGACGGTACTATGAGAAGGCATTTGAGGATTTCCAGCAGCTCAACTGCCGG
GCGATTGCGAAATCCTATATTAAGCTTGTCGAGCCGAGGAAGCAGGTCCACTACCCGTATAACGGGCGCAGGGTG
ATTGCCGGTGTCTCGCAGCGTGTTGACCCGGAGTTCACGAAGCCTGCGTGGTGGCCTGCTGGTGTCTTGCACAAA
GAGCCTGATCATCTGCTCAAACCTGGTGAGCATATCCTAGTATCACGATATGAACCAGATTAATACTGACTGACC
ATAGATCGTCTGCGACTTCTGGTTCATATCCTCTGTGAACTAAAGGATAGCCACGGAGTCACAACGGATAAGCTG
CGAGAAGCTGGCCAAGACGTCAGACGGCAGATCACACCTGCCCACCGGCTGCAGGTTCTCGACGAGATCTACTTT
GTGCGCCAAATGGAAGAACAATATCTGGATGGTGAAATCGGTATGTATCCCTATCCCGGCAAGATTCAATCTACA
GTTCACTGACATGTACTATAGACGCCAGCACCTTGATTCAGATAACACAGACACATCTACCCGAAGCAATCTTCC
CAGACGATGACCTATCATCTCGTGCACACGCAGCACCCGTAACAGCCCCTTCCATCGAGGCCGAACATAACATGC
ACGACGCCCGCGACAACCCTGTTATCTCCACGCTGGAAGACGATGACCCAAAGCTGCACCACTCGCATAGTCTGC
CCCTATCACCCACTACTAGCGAGTCCAGTGGTCCACACAGCCCAACTGGCAGTTTCGGCTACCCAATAGCCATAG
CACCCTCCGTGCATGTAATACCCCCTCTCGAGTCCCCCAATGTCACAAAGTCTATACATCCAGACCCGAGTTATC
TGTCGGGGTACTACTCGCAGCAATTCGTGTCTGATAAAGCGCCTGGGTTTTGGCCACATGCCAATACTGCCTCGC
AGTATGGCTATTGATGTTCTGTTTCTCTTGTTTTCCAGTACATAACTGGAGTTTGAGCGTTTGGCTGGACACGGA
TCTTGGGTTTCATTGGTTACTTTTCCATATATATATTTTCTTAGGATGGTTTGTTAATTAGCTTCCATATACGAG
AAGTCAGGGAGAATGCAAATTAATGGACAACCTGATCTCTCGTAGAGTCGACCTTATGAATTAGCTGCCTCAGGA
GTCAGGCGACACCTGGGCCAAGACGGCTCGCTGATTGGGTCCGCGTGACGATCCCCTAGCGCAGCTCCTCCATCC
AACCACCACTCACATCGCCAGCACACGTCAATTCCTCACCTTCTCGCTGGCTCTTGACTGTGTGTTTCTCCAACC
TTTTGGCCTGCACCAAAGCATCAGAAGCCCTACATCGCCGTTTCCGTGCCATGCGCCAGTAAGCCCGCAGTTGTT
TACTTCTTGGATCGCCAACCACAGTCCGCCATCCGCGCCCTCCGACTCCAACACACGCGTGATCTACCGATAAGG
TAACTTTGCCGTCTCTTTGGATGATTACCCCTCATATCTATATAATGGCCGTGTCGTTCGGCACTTGTGTCTGTT
TGGCACATCTAAAAAGTGCTTTTGAAGCTTGCAACTATGGGGATGCTAACTTTCAATCGGTTCCTCAGTCGACCG
TATCCCAACACCCGGGACGGACCGACAATACTCTGCTTCCAGCAACAGTTTCTAATGGAAAGCACCGGCTCGAGG
AGAAAATCCGATACCATGTCGGCCGAGCCTCCGGTCTCCACGCCAGTCGTGGAGGATGTGTCTTCAGATGACTCC
GACAACGATGAATCCGACTCTCCTGCCATAACCCCAGGAACCCTGTCGCGCAACGGCTCCTTCTCAAACAGCAGC
TCGTACCTAGAAGACTGGGAGTCATTTCCACCGCTGGACAAGCTGACTATTTTCGACCTCCTCGACAACATCCAC
CTCTCACAGCGTCTGGAGACTTGGCAGCAGACCCTCGCCGCGCAAAGGGAGAAGGTGCGCAAGCAGCGGGAGAAG
CTGAGGTTGTCGTCCTTGAATGCCAAGGACCGTGTTATGGGTGAATGGAAGCGCCATGCACCGACCGCCGAGGAG
AAGCTGGAGAAATATCGTGCTCGGATGAAGCATGGCGTTGAGCGTCTCGGCAAGCGGTGGAGCCAGACGGCGACT
GTCACCCTCCGGGAGAAGATGTCGTTTATTGCTGGTGTGCTCAATATCTTCATCAGCGGCTACCTGATCGGTGCT
TGCCCGGAGTACTTTTACTACTGGTTTAGCGGCCAGCTGGCTTTTTTCATGCCCATCCGCTACTTTACATACCAT
GCTAAAGGCTACCACTACTTCTTGGCCGATCTCTGCTACTTTGTCAATTTGCTCTGCATGCTGAGTATTTGGGTC
TTCCCGAACTCGAAACGGCTTTTCATTAGCACGTTCTGCTTGACTTTCGGAAACAATGCGGTTGCAATCGCCATG
TGGCGGAACTCGATGGTGTTCCACAGTATGGACAAGGTCGTCAGGTACGTTACACATCAAAAGGAACAAGTTCAT
CGCTCATCTTATCTAGTCTCTTCATCCATATTATGCCACCCGTGACTCTGCACTGCATCGTACACCTGACTCCGG
TTGCGATACTCAAGGAACGCTTCCCTGCTGTCTACGACATCAAGTTCAGTAAGCCCGGGGACCCAGAGCATTATG
GTCTTGGTGCCATGATCCTCTGGTCCACGGCCCCCTATGTGGTGTGGCAGCTCATGTACCACTTCCTGATTACCG
TGCGCCGCCGCGACCAAATCGCAGCGGGTCGTCCGACCAGCTTCACCTGGCTGCGCAAGTCATACTCCAAAGCGT
GGATTGGGCGGTTTGTGCTGAGTCTACCCGAGACGCTGCAAGAGCCATGCTTTATGGTGATCCAGTACGCGTACG
CTTTGTCCACCATGCTCCCCTGTCCGATCTGGTTCTGGTACAAATGGGCCAGCGGTCTGTTCATGTCTGCGCTAT
TCGTCTGGAGCATCCACAATGGAGCGACCTACTACATCGACGTCTTTGGAAGGCGCTTCCAAAAGGAGCTGGAAC
AGCTTAGGACAGATATGGCTCGTTGGCAGAACTCTCCCGAAGGATCAACTAGTCCTATCCTTATCCCTGAGCCCA
GCCCTCTCAGTGAAGCCATCAATGCACACAGCGAGGAGAAGCGATCTAGCGTTGATCGAATCCCTTTGTTGGAAA
CTGCCGATGTCTCCTCTACTGATATACCGGAGAAAGACAACAAGGATTCTGTTGTTCGAGAGCGAATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail