Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6781.t1
Gene name
Locationscaffold_19:12440..16472
Strand+
Gene length (bp)4032
Transcript length (bp)3777
Coding sequence length (bp)3777
Protein length (aa) 1259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02463 SMC_N RecF/RecN/SMC N terminal domain 2.0E-58 4 1242
PF06470 SMC_hinge SMC proteins Flexible Hinge Domain 8.6E-30 544 659
PF13555 AAA_29 P-loop containing region of AAA domain 1.8E-07 5 50

GO

GO Term Description Terminal node
GO:0005694 chromosome Yes
GO:0051276 chromosome organization Yes
GO:0005515 protein binding Yes
GO:0005524 ATP binding Yes
GO:0016043 cellular component organization No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044464 cell part No
GO:0097159 organic cyclic compound binding No
GO:0043228 non-membrane-bounded organelle No
GO:0032553 ribonucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0009987 cellular process No
GO:0043226 organelle No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0008150 biological_process No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0044424 intracellular part No
GO:0005488 binding No
GO:0006996 organelle organization No
GO:0036094 small molecule binding No
GO:0071840 cellular component organization or biogenesis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6781.t1
MGKLIRLELFNFKSYKGHHVLLFGDAYFTSIIGPNGSGKSNSMDAISFVLGIKSSHLRSSNLRDLVYRGRVLRTS
KVDGEPAADGQDGEEEEGPESMDVEQDAGGNDPKSAWVMAVYEDDAGEEQQWRRSITSQGVSEYRINNRIVSAHQ
YNEALEEENILIKARNFLVFQGDVEAIASQSPKDLTRLIEQISGSLEYKVDYEKFKAEAEEAAEQQTIQLNRRRG
INSEVKQYQEQKREAENYAKKAEERDQAIITHILWKLFHFQRLIDDSSADIQKYQNELKEYRRGVEKYDKNVEDA
KKDHARVGRDVGKAEKNITKKEREIEELNNSLVPVDEKIDITLKKVERYASKITEIEKERTSQSNNGKQLEKDLK
LVEKAQTQWEVEWQKTMSKKGGQLSEADQQEYRKLREEVNRRSSADSLNLDNLRRQRKTEAEAVNSLKGKFENTE
WQLKSVESDVQNMNERKASLNNTVKSTSKEIEHKKKELNALTSERLKVSQVRTELEEKLQVVLRKLLEADDGKKQ
TERELRAKELISALKRIFPGVKGRVSDLCRPKQKKYSDAVSTVLGRHFDAIVVDNEKTAKECIQHLRDQRAGQAT
FIPLETIQVKAFNSNLKGMHRGMRPAIETIDYDDSVARAISYACGNSIVCDDLATAKYLCYERNVDAKAVTLDGT
VIHKGGLMTGGRGPQQQNSKRWEDSEVENLYKLKEKLMGDLATLPKSHRRGSEEETLQGELVGLEQRLIYSRDEL
KALERNLESKLSELDFVKRQMEELRPKYTERKENLDELDETIETSQASVSTVEDEIYRSFCKRLGYDDIREYEAQ
QGSMQEEAAQKKLEFTTQKSRIENQLSFEKQRIQATEDRINGLKAQYERDQGLIEELQSQQEGIRNQLDEFEAEL
ELLREALEKQKEIYGQAAENLAEQRRELQKRSKHVESALKNVNALEADIQRNSSSRYTLLRRCKLEDIDIPLTES
SNSLDKLPIDDLVQAADPDAMEVDEGDGLDETAQVHDYGIEIDFDSLGETLKEEADDKLEDELLDKVRVLNSDLD
KMAPNARAMERLESVENKLRSTEKDFDDARKSARKAKEEFESVMKLRSDLFNKAFTHISEQIGPIYRELTRSPNY
PLGGQAYLDIEDSDEPYLDGIKYHAMPPLKRFRDMEHLSGGEKTMAALALLFAIHSYQPSPFFVLDEVDAALDNT
NVARIANYIHDHASPGMQFIVISLKTGLFQNSEALVGIYRDQVENSSKSLTLDLRKYT*
Coding >Pro_DTO377G3_2|g6781.t1
ATGGGAAAACTCATTCGTTTGGAGCTTTTCAACTTCAAGTCCTACAAGGGACATCATGTCCTCCTATTCGGAGAT
GCGTACTTCACCTCAATTATTGGCCCGAATGGGTCTGGCAAGTCAAACTCGATGGATGCCATATCTTTCGTTCTA
GGAATCAAGTCCTCTCACCTGCGATCGAGCAATCTCCGGGATCTTGTCTACCGTGGCCGTGTTTTGCGCACGTCT
AAAGTGGACGGAGAACCTGCTGCTGATGGACAGGATGGCGAGGAAGAGGAAGGGCCAGAGAGCATGGATGTGGAG
CAAGATGCCGGTGGAAACGACCCAAAGTCCGCTTGGGTGATGGCAGTCTATGAGGATGATGCGGGTGAGGAGCAA
CAATGGCGCCGATCTATTACCAGCCAAGGTGTCAGCGAATACCGCATCAACAACCGAATCGTGTCTGCCCACCAA
TACAACGAGGCATTAGAGGAGGAGAACATTCTGATCAAAGCGCGAAACTTCCTTGTGTTCCAGGGTGATGTTGAG
GCGATCGCATCCCAGTCGCCCAAAGACCTTACCCGGTTGATTGAGCAAATCTCTGGCAGTTTGGAGTATAAGGTC
GACTATGAAAAGTTCAAGGCGGAGGCGGAGGAGGCCGCAGAGCAGCAAACCATCCAGCTCAACCGTCGACGAGGC
ATCAACTCCGAAGTGAAGCAATACCAGGAACAGAAGCGAGAGGCTGAGAACTACGCGAAAAAGGCCGAAGAACGC
GACCAGGCCATTATCACTCATATCCTGTGGAAGCTGTTCCACTTCCAGCGGTTGATCGACGACTCCAGTGCTGAT
ATCCAGAAATACCAAAATGAGCTCAAAGAATACCGCCGTGGCGTTGAGAAATATGATAAGAACGTCGAGGATGCC
AAGAAGGACCATGCTCGAGTCGGCAGAGATGTTGGCAAGGCTGAGAAAAACATCACAAAAAAGGAGAGGGAGATT
GAAGAACTCAACAACTCACTTGTGCCTGTGGATGAGAAGATCGACATCACCCTGAAGAAGGTTGAGAGATACGCG
TCAAAGATTACTGAGATCGAAAAGGAGCGCACATCACAATCCAACAATGGCAAGCAACTAGAAAAGGACCTCAAG
CTTGTCGAAAAAGCTCAGACCCAATGGGAAGTTGAATGGCAGAAGACCATGAGCAAGAAGGGTGGCCAGCTGAGC
GAAGCCGATCAGCAGGAGTACCGTAAACTCAGAGAAGAAGTGAACCGACGTTCATCGGCGGACTCGTTGAACCTT
GACAATCTGCGACGGCAGAGAAAGACCGAAGCTGAAGCAGTCAATAGCTTGAAGGGCAAGTTTGAGAACACTGAA
TGGCAACTGAAGTCAGTTGAATCCGATGTCCAGAACATGAACGAACGCAAGGCGTCTCTCAATAACACCGTCAAG
TCCACATCCAAAGAGATCGAGCATAAGAAGAAGGAGTTGAACGCCTTGACTTCCGAGCGTTTGAAGGTCTCGCAA
GTGCGAACTGAGCTCGAGGAAAAGCTTCAGGTCGTGTTAAGGAAACTTCTCGAGGCTGATGATGGTAAGAAGCAG
ACTGAACGCGAACTCCGCGCCAAGGAGTTGATCTCGGCCTTGAAGCGCATCTTCCCCGGTGTCAAAGGCCGTGTC
AGTGATCTTTGCCGGCCGAAGCAGAAGAAATACTCCGATGCAGTCAGCACCGTACTAGGTCGACACTTTGACGCC
ATTGTTGTTGATAACGAGAAGACCGCGAAGGAGTGCATTCAGCACCTACGCGACCAACGCGCAGGTCAGGCCACG
TTCATTCCTCTGGAAACTATTCAAGTCAAGGCGTTCAACTCGAACCTGAAGGGCATGCATCGGGGCATGCGCCCT
GCCATTGAGACTATTGACTATGATGATTCAGTTGCACGAGCAATTAGTTACGCGTGCGGCAACTCTATTGTTTGT
GACGATCTGGCGACGGCCAAGTACCTTTGCTACGAAAGAAATGTGGATGCGAAGGCTGTCACCCTCGATGGAACT
GTCATCCACAAGGGTGGCCTCATGACTGGTGGACGTGGTCCTCAGCAGCAGAACTCCAAGCGCTGGGAAGATTCC
GAGGTCGAGAACCTATATAAATTAAAGGAGAAGCTCATGGGCGATCTCGCGACCCTCCCTAAGAGTCACCGCCGA
GGCTCTGAGGAAGAGACCCTGCAGGGCGAGCTCGTCGGTCTCGAGCAGCGCCTCATTTACTCTCGTGATGAGTTG
AAGGCTCTTGAAAGGAACCTCGAGAGCAAGCTTAGCGAGCTGGACTTCGTTAAGCGCCAGATGGAAGAACTGCGA
CCCAAATACACCGAGCGCAAGGAAAACCTTGATGAGCTAGATGAGACAATCGAAACGTCACAAGCTTCAGTTAGC
ACTGTCGAGGATGAGATTTACCGCAGTTTCTGCAAGCGCCTAGGGTATGATGATATTCGAGAATATGAAGCCCAG
CAGGGCTCTATGCAGGAAGAGGCCGCACAAAAAAAGCTTGAGTTCACCACCCAGAAGAGCCGAATCGAGAACCAG
CTCAGCTTTGAGAAGCAGCGTATCCAAGCAACCGAGGACCGAATCAACGGCCTTAAGGCCCAATACGAGCGTGAT
CAGGGCCTGATTGAAGAGCTACAAAGCCAGCAAGAAGGAATCCGCAACCAGCTCGATGAGTTCGAAGCGGAACTT
GAACTCCTCCGAGAGGCCCTCGAGAAGCAAAAGGAAATCTATGGACAAGCAGCAGAAAACTTGGCAGAGCAGCGT
CGTGAACTCCAGAAGCGTAGCAAGCACGTTGAATCAGCGTTAAAGAATGTTAATGCACTTGAAGCAGACATTCAG
AGAAACTCTTCCAGTCGTTACACTCTTTTGCGCCGCTGCAAGCTTGAAGACATTGATATTCCTTTGACCGAGTCT
TCCAATTCCCTTGACAAGCTTCCAATTGATGACCTTGTGCAAGCAGCAGACCCTGATGCCATGGAGGTGGATGAA
GGAGATGGTTTGGACGAGACTGCCCAGGTGCATGATTACGGTATCGAGATCGACTTTGATTCTCTGGGTGAGACC
CTGAAAGAGGAGGCCGATGACAAGCTCGAGGATGAACTGCTCGACAAGGTCCGTGTTCTCAACAGTGACCTTGAC
AAGATGGCACCGAATGCTCGTGCCATGGAGCGCCTGGAGAGTGTCGAGAACAAACTTCGCAGCACCGAAAAAGAT
TTCGACGACGCCCGAAAGTCTGCACGAAAGGCCAAGGAAGAGTTTGAGTCCGTGATGAAGCTGCGATCCGACCTC
TTCAACAAGGCATTCACCCATATTTCTGAGCAGATCGGGCCCATTTACCGTGAACTCACGCGCAGTCCCAATTAC
CCCCTGGGTGGTCAAGCCTACCTCGATATTGAGGACTCGGACGAGCCATACCTGGACGGCATCAAATACCACGCC
ATGCCCCCTCTTAAACGTTTCCGAGACATGGAACATCTCTCCGGTGGCGAGAAGACCATGGCCGCACTCGCTCTG
CTATTCGCCATTCACTCATACCAGCCGTCTCCATTCTTCGTACTGGACGAGGTCGACGCAGCCCTGGACAACACC
AACGTCGCCCGCATCGCCAACTATATCCACGACCACGCCTCGCCGGGCATGCAGTTTATCGTGATTAGTCTGAAA
ACCGGACTGTTCCAGAACAGCGAGGCTCTGGTCGGTATCTACCGGGACCAGGTCGAGAACAGCAGCAAATCGTTG
ACGCTTGATCTTCGGAAGTACACCTAG
Transcript >Pro_DTO377G3_2|g6781.t1
ATGGGAAAACTCATTCGTTTGGAGCTTTTCAACTTCAAGTCCTACAAGGGACATCATGTCCTCCTATTCGGAGAT
GCGTACTTCACCTCAATTATTGGCCCGAATGGGTCTGGCAAGTCAAACTCGATGGATGCCATATCTTTCGTTCTA
GGAATCAAGTCCTCTCACCTGCGATCGAGCAATCTCCGGGATCTTGTCTACCGTGGCCGTGTTTTGCGCACGTCT
AAAGTGGACGGAGAACCTGCTGCTGATGGACAGGATGGCGAGGAAGAGGAAGGGCCAGAGAGCATGGATGTGGAG
CAAGATGCCGGTGGAAACGACCCAAAGTCCGCTTGGGTGATGGCAGTCTATGAGGATGATGCGGGTGAGGAGCAA
CAATGGCGCCGATCTATTACCAGCCAAGGTGTCAGCGAATACCGCATCAACAACCGAATCGTGTCTGCCCACCAA
TACAACGAGGCATTAGAGGAGGAGAACATTCTGATCAAAGCGCGAAACTTCCTTGTGTTCCAGGGTGATGTTGAG
GCGATCGCATCCCAGTCGCCCAAAGACCTTACCCGGTTGATTGAGCAAATCTCTGGCAGTTTGGAGTATAAGGTC
GACTATGAAAAGTTCAAGGCGGAGGCGGAGGAGGCCGCAGAGCAGCAAACCATCCAGCTCAACCGTCGACGAGGC
ATCAACTCCGAAGTGAAGCAATACCAGGAACAGAAGCGAGAGGCTGAGAACTACGCGAAAAAGGCCGAAGAACGC
GACCAGGCCATTATCACTCATATCCTGTGGAAGCTGTTCCACTTCCAGCGGTTGATCGACGACTCCAGTGCTGAT
ATCCAGAAATACCAAAATGAGCTCAAAGAATACCGCCGTGGCGTTGAGAAATATGATAAGAACGTCGAGGATGCC
AAGAAGGACCATGCTCGAGTCGGCAGAGATGTTGGCAAGGCTGAGAAAAACATCACAAAAAAGGAGAGGGAGATT
GAAGAACTCAACAACTCACTTGTGCCTGTGGATGAGAAGATCGACATCACCCTGAAGAAGGTTGAGAGATACGCG
TCAAAGATTACTGAGATCGAAAAGGAGCGCACATCACAATCCAACAATGGCAAGCAACTAGAAAAGGACCTCAAG
CTTGTCGAAAAAGCTCAGACCCAATGGGAAGTTGAATGGCAGAAGACCATGAGCAAGAAGGGTGGCCAGCTGAGC
GAAGCCGATCAGCAGGAGTACCGTAAACTCAGAGAAGAAGTGAACCGACGTTCATCGGCGGACTCGTTGAACCTT
GACAATCTGCGACGGCAGAGAAAGACCGAAGCTGAAGCAGTCAATAGCTTGAAGGGCAAGTTTGAGAACACTGAA
TGGCAACTGAAGTCAGTTGAATCCGATGTCCAGAACATGAACGAACGCAAGGCGTCTCTCAATAACACCGTCAAG
TCCACATCCAAAGAGATCGAGCATAAGAAGAAGGAGTTGAACGCCTTGACTTCCGAGCGTTTGAAGGTCTCGCAA
GTGCGAACTGAGCTCGAGGAAAAGCTTCAGGTCGTGTTAAGGAAACTTCTCGAGGCTGATGATGGTAAGAAGCAG
ACTGAACGCGAACTCCGCGCCAAGGAGTTGATCTCGGCCTTGAAGCGCATCTTCCCCGGTGTCAAAGGCCGTGTC
AGTGATCTTTGCCGGCCGAAGCAGAAGAAATACTCCGATGCAGTCAGCACCGTACTAGGTCGACACTTTGACGCC
ATTGTTGTTGATAACGAGAAGACCGCGAAGGAGTGCATTCAGCACCTACGCGACCAACGCGCAGGTCAGGCCACG
TTCATTCCTCTGGAAACTATTCAAGTCAAGGCGTTCAACTCGAACCTGAAGGGCATGCATCGGGGCATGCGCCCT
GCCATTGAGACTATTGACTATGATGATTCAGTTGCACGAGCAATTAGTTACGCGTGCGGCAACTCTATTGTTTGT
GACGATCTGGCGACGGCCAAGTACCTTTGCTACGAAAGAAATGTGGATGCGAAGGCTGTCACCCTCGATGGAACT
GTCATCCACAAGGGTGGCCTCATGACTGGTGGACGTGGTCCTCAGCAGCAGAACTCCAAGCGCTGGGAAGATTCC
GAGGTCGAGAACCTATATAAATTAAAGGAGAAGCTCATGGGCGATCTCGCGACCCTCCCTAAGAGTCACCGCCGA
GGCTCTGAGGAAGAGACCCTGCAGGGCGAGCTCGTCGGTCTCGAGCAGCGCCTCATTTACTCTCGTGATGAGTTG
AAGGCTCTTGAAAGGAACCTCGAGAGCAAGCTTAGCGAGCTGGACTTCGTTAAGCGCCAGATGGAAGAACTGCGA
CCCAAATACACCGAGCGCAAGGAAAACCTTGATGAGCTAGATGAGACAATCGAAACGTCACAAGCTTCAGTTAGC
ACTGTCGAGGATGAGATTTACCGCAGTTTCTGCAAGCGCCTAGGGTATGATGATATTCGAGAATATGAAGCCCAG
CAGGGCTCTATGCAGGAAGAGGCCGCACAAAAAAAGCTTGAGTTCACCACCCAGAAGAGCCGAATCGAGAACCAG
CTCAGCTTTGAGAAGCAGCGTATCCAAGCAACCGAGGACCGAATCAACGGCCTTAAGGCCCAATACGAGCGTGAT
CAGGGCCTGATTGAAGAGCTACAAAGCCAGCAAGAAGGAATCCGCAACCAGCTCGATGAGTTCGAAGCGGAACTT
GAACTCCTCCGAGAGGCCCTCGAGAAGCAAAAGGAAATCTATGGACAAGCAGCAGAAAACTTGGCAGAGCAGCGT
CGTGAACTCCAGAAGCGTAGCAAGCACGTTGAATCAGCGTTAAAGAATGTTAATGCACTTGAAGCAGACATTCAG
AGAAACTCTTCCAGTCGTTACACTCTTTTGCGCCGCTGCAAGCTTGAAGACATTGATATTCCTTTGACCGAGTCT
TCCAATTCCCTTGACAAGCTTCCAATTGATGACCTTGTGCAAGCAGCAGACCCTGATGCCATGGAGGTGGATGAA
GGAGATGGTTTGGACGAGACTGCCCAGGTGCATGATTACGGTATCGAGATCGACTTTGATTCTCTGGGTGAGACC
CTGAAAGAGGAGGCCGATGACAAGCTCGAGGATGAACTGCTCGACAAGGTCCGTGTTCTCAACAGTGACCTTGAC
AAGATGGCACCGAATGCTCGTGCCATGGAGCGCCTGGAGAGTGTCGAGAACAAACTTCGCAGCACCGAAAAAGAT
TTCGACGACGCCCGAAAGTCTGCACGAAAGGCCAAGGAAGAGTTTGAGTCCGTGATGAAGCTGCGATCCGACCTC
TTCAACAAGGCATTCACCCATATTTCTGAGCAGATCGGGCCCATTTACCGTGAACTCACGCGCAGTCCCAATTAC
CCCCTGGGTGGTCAAGCCTACCTCGATATTGAGGACTCGGACGAGCCATACCTGGACGGCATCAAATACCACGCC
ATGCCCCCTCTTAAACGTTTCCGAGACATGGAACATCTCTCCGGTGGCGAGAAGACCATGGCCGCACTCGCTCTG
CTATTCGCCATTCACTCATACCAGCCGTCTCCATTCTTCGTACTGGACGAGGTCGACGCAGCCCTGGACAACACC
AACGTCGCCCGCATCGCCAACTATATCCACGACCACGCCTCGCCGGGCATGCAGTTTATCGTGATTAGTCTGAAA
ACCGGACTGTTCCAGAACAGCGAGGCTCTGGTCGGTATCTACCGGGACCAGGTCGAGAACAGCAGCAAATCGTTG
ACGCTTGATCTTCGGAAGTACACCTAG
Gene >Pro_DTO377G3_2|g6781.t1
ATGGGAAAACTCATTCGTTTGGAGCTTTTCAGTATGTACCGACCGGAAGGTGCGCAGGCAGTTGCTAACTTTGTT
ACTAGACTTCAAGTCCTACAAGGGACATCATGTCCTCCTATTCGGAGATGCGTACTTCACCTCAATTATTGGCCC
GAATGGGTCTGGCAAGTCAAACTCGTGAGTGCCTCCTCGCCTCAGTCTAAAGGACCCAAGCTAACGCGCGTTAGG
ATGGATGCCATATCTTTCGTTCTAGGAATCAAGTCCTCTCACCTGCGATCGAGCAATCTCCGGGATCTTGTCTAC
CGTGGCCGTGTTTTGCGCACGTCTAAAGTGGACGGAGAACCTGCTGCTGATGGACAGGATGGCGAGGAAGAGGAA
GGGCCAGAGAGCATGGATGTGGAGCAAGATGCCGGTGGAAACGACCCAAAGTCCGCTTGGGTGATGGCAGTCTAT
GAGGATGATGCGGGTGAGGAGCAACAATGGCGCCGATCTATTACCAGCCAAGGTGTCAGCGAATACCGCATCAAC
AACCGAATCGTGTCTGCCCACCAATACAACGAGGCATTAGAGGAGGAGAACATTCTGATCAAAGCGCGAAACTTC
CTTGTGTTCCAGGGTGATGTTGAGGCGATCGCATCCCAGTCGCCCAAAGACCTTACCCGGTTGATTGAGCAAATC
TCTGGCAGTTTGGAGTATAAGGTCGACTATGAAAAGTTCAAGGCGGAGGCGGAGGAGGCCGCAGAGCAGCAAACC
ATCCAGCTCAACCGTCGACGAGGCATCAACTCCGAAGTGAAGCAATACCAGGAACAGAAGCGAGAGGCTGAGAAC
TACGCGAAAAAGGCCGAAGAACGCGACCAGGCCATTATCACTCATATCCTGTGGAAGCTGTTCCACTTCCAGCGG
TTGATCGACGACTCCAGTGCTGATATCCAGAAATACCAAAATGAGCTCAAAGAATACCGCCGTGGCGTTGAGAAA
TATGATAAGAACGTCGAGGATGCCAAGAAGGACCATGCTCGAGTCGGCAGAGATGTTGGCAAGGCTGAGAAAAAC
ATCACAAAAAAGGAGAGGGAGATTGAAGAACTCAACAACTCACTTGTGCCTGTGGATGAGAAGATCGACATCACC
CTGAAGAAGGTTGAGAGATACGCGTCAAAGATTACTGAGATCGAAAAGGAGCGCACATCACAATCCAACAATGGC
AAGCAACTAGAAAAGGACCTCAAGCTTGTCGAAAAAGCTCAGACCCAATGGGAAGTTGAATGGCAGAAGACCATG
AGCAAGAAGGGTGGCCAGCTGAGCGAAGCCGATCAGCAGGAGTACCGTAAACTCAGAGAAGAAGTGAACCGACGT
TCATCGGCGGACTCGTTGAACCTTGACAATCTGCGACGGCAGAGAAAGACCGAAGCTGAAGCAGTCAATAGCTTG
AAGGGCAAGTTTGAGAACACTGAATGGCAACTGAAGTCAGTTGAATCCGATGTCCAGAACATGAACGAACGCAAG
GCGTCTCTCAATAACACCGTCAAGTCCACATCCAAAGAGATCGAGCATAAGAAGAAGGAGTTGAACGCCTTGACT
TCCGAGCGTTTGAAGGTCTCGCAAGTGCGAACTGAGCTCGAGGAAAAGCTTCAGGTCGTGTTAAGGAAACTTCTC
GAGGCTGATGATGGTAAGAAGCAGACTGAACGCGAACTCCGCGCCAAGGAGTTGATCTCGGCCTTGAAGCGCATC
TTCCCCGGTGTCAAAGGCCGTGTCAGTGATCTTTGCCGGCCGAAGCAGAAGAAATACTCCGATGCAGTCAGCACC
GTACTAGGTCGACACTTTGACGCCATTGTTGTTGATAACGAGAAGACCGCGAAGGAGTGCATTCAGCACCTACGC
GACCAACGCGCAGGTCAGGCCACGTTCATTCCTCTGGAAACTATTCAAGTCAAGGCGTTCAACTCGAACCTGAAG
GGCATGCATCGGGGCATGCGCCCTGCCATTGAGACTATTGACTATGATGATTCAGTTGCACGAGCAATTAGTTAC
GCGTGCGGCAACTCTATTGTTTGTGACGATCTGGCGACGGCCAAGTACCTTTGCTACGAAAGAAATGTGGATGCG
AAGGCTGTCACCCTCGATGGAACTGTCATCCACAAGGGTGGCCTCATGACTGGTGGACGTGGTCCTCAGCAGCAG
AACTCCAAGCGCTGGGAAGATTCCGAGGTCGAGAACCTATATAAATTAAAGGAGAAGCTCATGGGCGATCTCGCG
ACCCTCCCTAAGAGTCACCGCCGAGGCTCTGAGGAAGAGACCCTGCAGGGCGAGCTCGTCGGTCTCGAGCAGCGC
CTCATTTACTCTCGTGATGAGTTGAAGGCTCTTGAAAGGAACCTCGAGAGCAAGCTTAGCGAGCTGGACTTCGTT
AAGCGCCAGATGGAAGAACTGCGACCCAAATACACCGAGCGCAAGGAAAACCTTGATGAGCTAGATGAGACAATC
GAAACGTCACAAGCTTCAGTTAGCACTGTCGAGGATGAGATTTACCGCAGTTTCTGCAAGCGCCTAGGGTATGAT
GATATTCGAGAATATGAAGCCCAGCAGGGCTCTATGCAGGAAGAGGCCGCACAAAAAAAGCTTGAGTTCACCACC
CAGAAGAGCCGAATCGAGAACCAGCTCAGCTTTGAGAAGCAGCGTATCCAAGCAACCGAGGACCGAATCAACGGC
CTTAAGGCCCAATACGAGCGTGATCAGGGCCTGATTGAAGAGCTACAAAGCCAGCAAGAAGGAATCCGCAACCAG
CTCGATGAGTTCGAAGCGGAACTTGAACTCCTCCGAGAGGCCCTCGAGAAGCAAAAGGAAATCTATGGACAAGCA
GCAGAAAACTTGGCAGAGCAGCGTCGTGAACTCCAGAAGCGTAGCAAGCACGTTGAATCAGCGTTAAAGAATGTT
AATGCACTTGAAGCAGACATTCAGAGAAACTCTTCCAGTCGTTACACTCTTTTGCGCCGCTGCAAGCTTGAAGAC
ATTGATATTCCTTTGACCGAGTCTTCCAATTCCCTTGACAAGCTTCCAATTGATGACCTTGTGCAAGCAGCAGAC
CCTGATGCCATGGAGGTGGATGAAGGAGATGGTTTGGACGAGACTGCCCAGGTGCATGATTACGGTATCGAGATC
GACTTTGATTCTCTGGGTGAGACCCTGAAAGAGGTTTGTTCTCCTATCCATTGCTTATTTGTCACATACTAATTC
AATTCCAGGAGGCCGATGACAAGCTCGAGGATGAACTGCTCGACAAGGTCCGTGTTCTCAACAGTGACCTTGACA
AGATGGCACCGAATGCTCGTGCCATGGAGCGCCTGGAGAGTGTCGAGAACAAACTTCGCAGCACCGAAAAAGATT
TCGACGACGCCCGAAAGTCTGCACGAAAGGCCAAGGAAGAGTTTGAGTCCGTGATGAAGCTGCGATCCGACCTCT
TCAACAAGGCATTCACCCATATTTCTGAGCAGATCGGGCCCATTTACCGTGAACTCACGCGCAGTCCCAATTACC
CCCTGGGTGGTCAAGCGTAGGTTTCCTCAACTCCCGACTTTGAATAATCGCTAACATCTCAAAGCTACCTCGATA
TTGAGGACTCGGACGAGCCATACCTGGACGGCATCAAATACCACGCCATGCCCCCTCTTAAACGTTTCCGAGACA
TGGAACATCTCTCCGGTGGCGAGAAGACCATGGCCGCACTCGCTCTGCTATTCGCCATTCACTCATACCAGCCGT
CTCCATTCTTCGTACTGGACGAGGTCGACGCAGCCCTGGACAACACCAACGTCGCCCGCATCGCCAACTATATCC
ACGACCACGCCTCGCCGGGCATGCAGTTTATCGTGATTAGTCTGAAAACCGGACTGTTCCAGAACAGCGAGGCTC
TGGTCGGTATCTACCGGGACCAGGTCGAGAACAGCAGCAAATCGTTGACGCTTGATGTGAGTTTTAATGTGGTTC
GTATGCGATATGGAAATATGCTGACAATGATTGTTCCAGCTTCGGAAGTACACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail