Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6777.t1
Gene name
Locationscaffold_19:179..5855
Strand-
Gene length (bp)5676
Transcript length (bp)3333
Coding sequence length (bp)3333
Protein length (aa) 1111

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02127 Peptidase_M18 Aminopeptidase I zinc metalloprotease (M18) 1.7E-163 13 458
PF13401 AAA_22 AAA domain 3.5E-06 753 902

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008270 zinc ion binding Yes
GO:0004177 aminopeptidase activity Yes
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0008238 exopeptidase activity No
GO:0019538 protein metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0043169 cation binding No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 50.85 31.06 70.65
5d_25C Five days - 25 degrees Celsius 45.27 27.80 62.74
7d_25C Seven days - 25 degrees Celsius 44.14 26.94 61.34
10d_25C Ten days - 25 degrees Celsius 44.16 27.10 61.23
7d_15C Seven days - 15 degrees Celsius 52.93 32.24 73.62
7d_30C Seven days - 30 degrees Celsius 39.93 24.42 55.44

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.668595 no
3d_25C 7d_25C 0.599585 no
3d_25C 7d_15C 0.905625 no
3d_25C 7d_30C 0.297205 no
3d_25C 10d_25C 0.589325 no
5d_25C 7d_25C 0.941052 no
5d_25C 7d_15C 0.543181 no
5d_25C 7d_30C 0.637903 no
5d_25C 10d_25C 0.940770 no
7d_25C 7d_15C 0.473567 no
7d_25C 7d_30C 0.726566 no
7d_25C 10d_25C 0.998471 no
7d_15C 7d_30C 0.200865 no
7d_15C 10d_25C 0.460579 no
7d_30C 10d_25C 0.717430 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6777.t1
MAAKQPALDFLTFVNAAPTPFHAVHEAKQLLDKAGFQEIKERDSWASTCQPGGKYYLTRNTTTLVAFAIGKQWQP
GNAISMIGAHTDSPVLRVKPVSKKSGEGFVQVGVETYGGGIWHTWFDRDLGVAGRVMTRESDGSIVQKLVKIDRP
ILRVPTLAIHLDRQENFSFNKETQLFPIAGLIAAELNRNDGADTPDTDKGGELFSPLKSVTERHHSHFVELIANE
AGVSPSDILDFEMILFDTQKSCLGGMLEEFIFSPRLDNLNSTFCATVGLIDSVADKSALDDEEAIRLIALFDHEE
IGSRTAQGADSNILPSIIRRLSVLPSSSSKSTDLSTAYEQTLSTSFLVSADMAHSVNPNYSGKYESDHKPEMNKG
LVIKINANARYATNSPGIVLLEEIARKTTKETGVHVPLQLFVVRNDSSCGSTIGPMLSAALGARTLDLGNPQLSM
HSIRETGALREALIEFEGILTEEQRGLYKVSATKPDVASVIAFVTEIDANNSTTRRCVAPRLCTFLEATQQFSDV
VGTFISSNPQIAALIWGGVKMAILTASNITSYFDKVTKMIMEIGRSCPTYQQFGQLYPDCISLQRELCEYYAAIV
QLCTKIIEVSRRPPITQTLSSIFNPFESDFKSPLDKLKQATKDIQLQISLASKQANEETKKLLENESQNNAASRK
LTNKFRKETQKEHTEAHQWRIHMMKREAASLRSSIRQNLSTIDYVKPWKQAIQQRVPSTAEWLLQEFLFHDWQDD
QNTAILWCPGTMGMGKTVLISNVVAQLHASRNTNDIISYYICRADNTASLSARNIIGSLARQILDSQIKHAEDES
LQRLYEDSNDLNTAEVVDFVLSRLHDDNTYYLAIDGLDECEPVEIRKVAQSVAKLCNMRVKNFKVLYTGRPELEN
QLFGAMKPKYKIPVTETKVDLEMDRYIAAAIGNCLEDKQLILGDPTLIVKIFETLKKGSNGMFLWTRLFIEELCE
QGSDSDILDALKHPPRGLSEIFDRKLSRVRERTLGKDAFKILQFCGVMKRPLTAMEYQEVLGLFPGQMSLDRKKL
PNDMNKREMDEQRSRQQRKEVISRSWSDFSLQQQMSMRPPQRKMDEQPFKQQRKEAIFRW*
Coding >Pro_DTO377G3_2|g6777.t1
ATGGCTGCCAAGCAACCTGCTCTGGACTTCTTGACCTTTGTCAATGCTGCTCCTACCCCTTTCCATGCCGTCCAC
GAAGCGAAACAGCTTCTGGATAAGGCTGGCTTTCAAGAAATCAAGGAAAGAGACTCTTGGGCGTCGACCTGCCAA
CCGGGAGGCAAGTACTACTTGACTCGCAACACTACTACCCTCGTGGCTTTTGCGATCGGCAAGCAATGGCAGCCG
GGCAATGCCATCTCTATGATCGGTGCCCACACCGACTCTCCGGTGTTGAGGGTCAAACCCGTTAGCAAGAAGAGC
GGGGAAGGCTTCGTCCAGGTCGGTGTAGAGACCTACGGCGGAGGCATCTGGCACACTTGGTTCGATCGTGATCTC
GGTGTCGCTGGGCGGGTTATGACTCGCGAAAGCGATGGATCCATCGTGCAGAAACTGGTCAAGATTGACCGTCCC
ATCCTCCGTGTTCCAACACTGGCCATCCATCTGGACCGCCAGGAAAACTTTTCATTCAATAAGGAAACACAGCTG
TTCCCTATCGCTGGCCTTATTGCTGCAGAGCTTAACCGCAATGATGGAGCCGACACCCCTGATACAGACAAGGGT
GGGGAATTATTCTCACCATTGAAATCTGTCACAGAACGTCACCACTCTCACTTCGTTGAGCTTATTGCTAACGAG
GCTGGTGTCAGTCCCAGTGATATTCTGGACTTTGAAATGATCCTCTTCGACACTCAAAAGTCCTGTCTCGGCGGT
ATGCTGGAGGAATTCATCTTCTCCCCTCGTCTAGACAACCTGAACAGCACTTTCTGTGCTACAGTTGGTCTGATT
GACTCCGTGGCCGATAAATCAGCCCTCGACGACGAGGAAGCGATCCGCCTGATTGCCTTGTTTGACCACGAGGAA
ATCGGAAGCCGCACAGCACAGGGTGCGGACTCGAACATTCTTCCATCGATCATTCGCCGTCTATCCGTCCTCCCA
TCCTCCTCCTCCAAGAGCACCGACCTGTCAACTGCCTACGAGCAGACTCTGTCCACCTCCTTCCTTGTCTCTGCC
GACATGGCTCATTCGGTCAACCCGAACTATTCGGGGAAGTACGAATCAGACCATAAGCCGGAGATGAACAAAGGC
TTGGTGATTAAGATCAACGCCAACGCTCGCTATGCGACGAACTCTCCTGGAATTGTTCTCCTGGAGGAGATTGCG
CGCAAGACCACCAAGGAGACTGGCGTCCACGTTCCTCTTCAGCTCTTTGTGGTCCGTAATGACTCGAGCTGTGGC
AGCACCATTGGCCCTATGCTGTCTGCTGCGCTGGGCGCGCGGACACTTGATCTAGGCAATCCCCAGCTCAGTATG
CACAGTATCCGTGAAACAGGTGCTCTCCGGGAGGCGTTGATTGAATTCGAGGGTATTCTGACGGAGGAGCAAAGG
GGACTCTATAAAGTCAGCGCTACGAAACCAGACGTTGCGAGCGTCATCGCATTCGTGACGGAGATCGACGCCAAC
AACAGCACGACAAGGAGATGTGTGGCACCGAGGTTGTGTACATTTCTGGAGGCGACACAACAGTTCAGTGATGTC
GTGGGTACATTTATCAGCTCCAATCCTCAAATCGCCGCCCTAATCTGGGGCGGCGTTAAGATGGCTATATTGACG
GCAAGCAATATTACATCTTACTTCGACAAGGTCACAAAAATGATTATGGAGATCGGAAGGTCGTGTCCAACCTAT
CAACAATTTGGTCAACTTTATCCCGACTGTATCAGCCTTCAACGTGAGCTATGCGAGTACTATGCAGCCATCGTC
CAATTGTGTACCAAGATCATCGAAGTATCAAGACGCCCGCCGATCACGCAAACTTTATCGTCTATTTTCAATCCC
TTCGAGTCTGATTTCAAAAGCCCTCTCGATAAACTAAAGCAAGCTACAAAGGACATACAGCTGCAGATATCACTT
GCCTCAAAGCAGGCTAACGAGGAAACAAAAAAATTGCTGGAAAACGAGAGCCAAAATAACGCAGCATCCCGAAAG
TTGACAAATAAATTCCGAAAAGAAACCCAAAAGGAACACACTGAGGCGCACCAGTGGAGAATCCACATGATGAAG
AGGGAAGCTGCAAGCTTGAGATCTAGCATTAGACAAAATCTTTCTACCATCGACTACGTCAAACCCTGGAAGCAA
GCTATCCAACAACGCGTGCCCTCCACAGCGGAGTGGCTACTGCAAGAGTTCCTTTTCCATGATTGGCAAGATGAC
CAAAATACTGCAATTCTCTGGTGCCCAGGCACGATGGGTATGGGAAAGACAGTGCTTATATCTAATGTGGTTGCC
CAACTTCATGCCTCACGAAATACCAATGACATTATTTCCTATTACATTTGTCGTGCGGACAACACTGCATCTCTG
TCAGCGAGAAACATTATCGGGAGTCTTGCTCGTCAAATATTAGACTCTCAGATCAAACACGCTGAAGATGAAAGT
CTACAACGCCTATACGAGGATAGCAATGACCTCAATACGGCTGAAGTAGTTGATTTCGTACTGTCTCGGCTCCAC
GATGACAATACATACTATCTAGCTATTGATGGACTGGATGAATGTGAACCTGTCGAGATCCGGAAGGTGGCGCAG
AGTGTGGCCAAACTTTGTAACATGCGCGTTAAAAACTTCAAAGTTCTCTATACAGGCCGCCCGGAGCTTGAAAAC
CAATTGTTTGGAGCCATGAAACCCAAATACAAAATCCCGGTGACCGAGACAAAAGTTGACTTGGAGATGGATCGC
TATATTGCCGCGGCTATAGGCAACTGCCTAGAAGACAAACAATTGATCTTGGGGGATCCCACGCTCATTGTGAAG
ATATTTGAAACCCTAAAAAAGGGATCCAACGGAATGTTCCTCTGGACGCGTCTTTTCATCGAAGAGCTCTGCGAA
CAAGGCAGTGACAGCGACATCTTAGATGCATTGAAGCATCCCCCTCGTGGCCTATCTGAAATATTTGACAGAAAA
CTCAGCCGTGTACGGGAGAGAACCTTGGGAAAAGACGCGTTCAAAATTCTCCAATTTTGTGGTGTGATGAAGCGG
CCATTGACAGCGATGGAATACCAGGAGGTTTTAGGTCTTTTTCCTGGACAAATGTCTCTTGACCGAAAAAAGCTC
CCCAACGACATGAATAAGAGGGAAATGGACGAACAGCGCTCCAGGCAGCAGCGCAAGGAGGTCATCTCAAGGTCG
TGGAGCGACTTCTCGCTGCAACAGCAAATGTCAATGCGCCCGCCGCAGAGGAAAATGGACGAACAGCCCTTCAAG
CAGCAGCGGAAGGAGGCCATCTTCAGGTGGTAG
Transcript >Pro_DTO377G3_2|g6777.t1
ATGGCTGCCAAGCAACCTGCTCTGGACTTCTTGACCTTTGTCAATGCTGCTCCTACCCCTTTCCATGCCGTCCAC
GAAGCGAAACAGCTTCTGGATAAGGCTGGCTTTCAAGAAATCAAGGAAAGAGACTCTTGGGCGTCGACCTGCCAA
CCGGGAGGCAAGTACTACTTGACTCGCAACACTACTACCCTCGTGGCTTTTGCGATCGGCAAGCAATGGCAGCCG
GGCAATGCCATCTCTATGATCGGTGCCCACACCGACTCTCCGGTGTTGAGGGTCAAACCCGTTAGCAAGAAGAGC
GGGGAAGGCTTCGTCCAGGTCGGTGTAGAGACCTACGGCGGAGGCATCTGGCACACTTGGTTCGATCGTGATCTC
GGTGTCGCTGGGCGGGTTATGACTCGCGAAAGCGATGGATCCATCGTGCAGAAACTGGTCAAGATTGACCGTCCC
ATCCTCCGTGTTCCAACACTGGCCATCCATCTGGACCGCCAGGAAAACTTTTCATTCAATAAGGAAACACAGCTG
TTCCCTATCGCTGGCCTTATTGCTGCAGAGCTTAACCGCAATGATGGAGCCGACACCCCTGATACAGACAAGGGT
GGGGAATTATTCTCACCATTGAAATCTGTCACAGAACGTCACCACTCTCACTTCGTTGAGCTTATTGCTAACGAG
GCTGGTGTCAGTCCCAGTGATATTCTGGACTTTGAAATGATCCTCTTCGACACTCAAAAGTCCTGTCTCGGCGGT
ATGCTGGAGGAATTCATCTTCTCCCCTCGTCTAGACAACCTGAACAGCACTTTCTGTGCTACAGTTGGTCTGATT
GACTCCGTGGCCGATAAATCAGCCCTCGACGACGAGGAAGCGATCCGCCTGATTGCCTTGTTTGACCACGAGGAA
ATCGGAAGCCGCACAGCACAGGGTGCGGACTCGAACATTCTTCCATCGATCATTCGCCGTCTATCCGTCCTCCCA
TCCTCCTCCTCCAAGAGCACCGACCTGTCAACTGCCTACGAGCAGACTCTGTCCACCTCCTTCCTTGTCTCTGCC
GACATGGCTCATTCGGTCAACCCGAACTATTCGGGGAAGTACGAATCAGACCATAAGCCGGAGATGAACAAAGGC
TTGGTGATTAAGATCAACGCCAACGCTCGCTATGCGACGAACTCTCCTGGAATTGTTCTCCTGGAGGAGATTGCG
CGCAAGACCACCAAGGAGACTGGCGTCCACGTTCCTCTTCAGCTCTTTGTGGTCCGTAATGACTCGAGCTGTGGC
AGCACCATTGGCCCTATGCTGTCTGCTGCGCTGGGCGCGCGGACACTTGATCTAGGCAATCCCCAGCTCAGTATG
CACAGTATCCGTGAAACAGGTGCTCTCCGGGAGGCGTTGATTGAATTCGAGGGTATTCTGACGGAGGAGCAAAGG
GGACTCTATAAAGTCAGCGCTACGAAACCAGACGTTGCGAGCGTCATCGCATTCGTGACGGAGATCGACGCCAAC
AACAGCACGACAAGGAGATGTGTGGCACCGAGGTTGTGTACATTTCTGGAGGCGACACAACAGTTCAGTGATGTC
GTGGGTACATTTATCAGCTCCAATCCTCAAATCGCCGCCCTAATCTGGGGCGGCGTTAAGATGGCTATATTGACG
GCAAGCAATATTACATCTTACTTCGACAAGGTCACAAAAATGATTATGGAGATCGGAAGGTCGTGTCCAACCTAT
CAACAATTTGGTCAACTTTATCCCGACTGTATCAGCCTTCAACGTGAGCTATGCGAGTACTATGCAGCCATCGTC
CAATTGTGTACCAAGATCATCGAAGTATCAAGACGCCCGCCGATCACGCAAACTTTATCGTCTATTTTCAATCCC
TTCGAGTCTGATTTCAAAAGCCCTCTCGATAAACTAAAGCAAGCTACAAAGGACATACAGCTGCAGATATCACTT
GCCTCAAAGCAGGCTAACGAGGAAACAAAAAAATTGCTGGAAAACGAGAGCCAAAATAACGCAGCATCCCGAAAG
TTGACAAATAAATTCCGAAAAGAAACCCAAAAGGAACACACTGAGGCGCACCAGTGGAGAATCCACATGATGAAG
AGGGAAGCTGCAAGCTTGAGATCTAGCATTAGACAAAATCTTTCTACCATCGACTACGTCAAACCCTGGAAGCAA
GCTATCCAACAACGCGTGCCCTCCACAGCGGAGTGGCTACTGCAAGAGTTCCTTTTCCATGATTGGCAAGATGAC
CAAAATACTGCAATTCTCTGGTGCCCAGGCACGATGGGTATGGGAAAGACAGTGCTTATATCTAATGTGGTTGCC
CAACTTCATGCCTCACGAAATACCAATGACATTATTTCCTATTACATTTGTCGTGCGGACAACACTGCATCTCTG
TCAGCGAGAAACATTATCGGGAGTCTTGCTCGTCAAATATTAGACTCTCAGATCAAACACGCTGAAGATGAAAGT
CTACAACGCCTATACGAGGATAGCAATGACCTCAATACGGCTGAAGTAGTTGATTTCGTACTGTCTCGGCTCCAC
GATGACAATACATACTATCTAGCTATTGATGGACTGGATGAATGTGAACCTGTCGAGATCCGGAAGGTGGCGCAG
AGTGTGGCCAAACTTTGTAACATGCGCGTTAAAAACTTCAAAGTTCTCTATACAGGCCGCCCGGAGCTTGAAAAC
CAATTGTTTGGAGCCATGAAACCCAAATACAAAATCCCGGTGACCGAGACAAAAGTTGACTTGGAGATGGATCGC
TATATTGCCGCGGCTATAGGCAACTGCCTAGAAGACAAACAATTGATCTTGGGGGATCCCACGCTCATTGTGAAG
ATATTTGAAACCCTAAAAAAGGGATCCAACGGAATGTTCCTCTGGACGCGTCTTTTCATCGAAGAGCTCTGCGAA
CAAGGCAGTGACAGCGACATCTTAGATGCATTGAAGCATCCCCCTCGTGGCCTATCTGAAATATTTGACAGAAAA
CTCAGCCGTGTACGGGAGAGAACCTTGGGAAAAGACGCGTTCAAAATTCTCCAATTTTGTGGTGTGATGAAGCGG
CCATTGACAGCGATGGAATACCAGGAGGTTTTAGGTCTTTTTCCTGGACAAATGTCTCTTGACCGAAAAAAGCTC
CCCAACGACATGAATAAGAGGGAAATGGACGAACAGCGCTCCAGGCAGCAGCGCAAGGAGGTCATCTCAAGGTCG
TGGAGCGACTTCTCGCTGCAACAGCAAATGTCAATGCGCCCGCCGCAGAGGAAAATGGACGAACAGCCCTTCAAG
CAGCAGCGGAAGGAGGCCATCTTCAGGTGGTAG
Gene >Pro_DTO377G3_2|g6777.t1
ATGGCTGCCAAGCAACCTGCTCTGGACTTCTTGACCTTTGTCAATGCTGCTCCTACCCGTATGTAGTTCTATCGA
TGACGTGGAATGTCGCTGATTTGTCTTATCTCCAGCTTTCCATGCCGTCCACGAAGCGAAACAGCTTCTGGATAA
GGCTGGCTTTCAAGAAATCAAGGTCGGCTCAAGCTGAATACCGGAGTAATAAATTGTGGCTCATCCATCAATAGG
AAAGAGACTCTTGGGCGTCGACCTGCCAACCGGGAGGCAAGTACTACTTGACTCGCAACACTACTACCCTCGTGG
CTTTTGCGATCGGCAAGCAATGGCAGGTATGTATAAATTGCGGAACTGCGTAAATGGTCTTTCAATTAATCATGT
CAATGAATATAGCCGGGCAATGCCATCTCTATGATCGGTGCCCACACCGACTCTCCGGTGTTGAGGGTCAAACCC
GTTAGCAAGAAGAGCGGGGAAGGCTTCGTCCAGGTCGGTGTAGAGACCTACGGCGGAGGCATCTGGCACACTTGT
ACGTGCCATTGATTACCTTCAAACTATCATAGTCGCTAATTTCCTGCAGGGTTCGATCGTGATCTCGGTGTCGCT
GGGCGGGTTATGACTCGCGAAAGCGATGGATCCATCGTGCAGAAACTGGTCAAGATTGACCGTCCCAGTATGTTT
CATGTTGACCCAATAAATGTGCCTTGCTAACAAGGTAGTCCTCCGTGTTCCAACACTGGCCATCCATCTGGACCG
CCAGGAAAACTTTTCATTCAATAAGGAAACACAGCTGTTCCCTATCGCTGGCCTTATTGCTGCAGAGCTTAACCG
CAATGATGGAGCCGACACCCCTGATACAGACAAGGGTGGGGAATTATTCTCACCATTGAAATCTGTCACAGAACG
TCACCACTCTCACTTCGTTGAGCTTATTGCTAACGAGGCTGGTGTCAGTCCCAGTGATATTCTGGACTTTGAAAT
GATCCTCTTCGACACTCAAAAGTCCTGTCTCGGCGGTATGCTGGAGGAATTCATCTTCTCCCCTCGTCTAGACAA
CCTGAACAGCACTTTCTGTGCTACAGTTGGTCTGATTGACTCCGTGGCCGATAAATCAGCCCTCGACGACGAGGA
AGCGATCCGCCTGATTGCCTTGTTTGACCACGAGGAAATCGGAAGCCGCACAGCACAGGGTGCGGACTCGAACAT
TCTTCCATCGATCATTCGCCGTCTATCCGTCCTCCCATCCTCCTCCTCCAAGAGCACCGACCTGTCAACTGCCTA
CGAGCAGACTCTGTCCACCTCCTTCCTTGTCTCTGCCGACATGGCTCATTCGGTCAACCCGAACTATTCGGGGAA
GTACGAATCAGACCATAAGCCGGAGATGAACAAAGGCTTGGTGATTAAGATCAACGCCAACGCTCGCTATGCGAC
GAACTCTCCTGGAATTGTTCTCCTGGAGGAGATTGCGCGCAAGACCACCAAGGAGACTGGCGTCCACGTTCCTCT
TCAGCTCTTTGTGGTCCGTAATGACTCGAGCTGTGGCAGCACCATTGGCCCTATGCTGTCTGCTGCGCTGGGCGC
GCGGACACTTGATCTAGGCAATCCCCAGCTCAGTATGCACAGTATCCGTGAAACAGGTGGTACTTATGATGTTGC
CCATGCCATTCGTTTGTTCACTGGCTTCTTCAAGCATTACTCAGAGCTGTCGAAGAAGATCATTGTGGATTAAGC
TTACCGTGAATAAGTAGATGAAGTAGTACAATCAATACTATTCAAACAGTCCAGTATTCCATTTCCAAGCATTCG
AATATAAACACTCAAACATCTTAAAATAAAACACAAACGTACTGTGCATGTACCTTGGGGAAAGCACGTGGTCCG
GGCCGAGGAAAATCCACTACCCGAAGTATTAATATCCCAGATTCCCAGTAGTCTACACCAGAATATGAGGACCTG
TAGAATTGACGCCAAAAACGGCCATTCTCTACCTCAAAAAGCAAAACAAAAACATACAACAGTGAGGATTCGCTG
GTGGTCACCCACCCAACTACTACCCCGGACTATTCTTAGCCTCCGAATTTCTAATGCGATTGGTCTGCGATGGTC
TGTCACCCCGCAACGTGATCCTTACGTAGGCGAGGAGCTTATAACTAGGTAACTCAGCGGCGTGTGGCTTATACG
CAGTCGATAGTCGGGTGGGTGTCGCCCGGGTGAGAAATGGATGAGCGCCGTTTTACGGTCGCGCGACCGGGGGTG
AGAAGGGTGAGTGTACTATACAATTCTTTACGCCAAGCGATACATGTACATCGTGTCTTGTTACTGTATGGAGTG
GCTAGAACTTCCCATACTTTAGGCTAAGATTGTGCCGCTCTTCAGCTTGTTGCCTGACAAAACGTGGCTTAGACG
TTTTACCACCCTCAGCCCCCTTCAGCTGAGGGGAATCGTATCTTTAGATTTGATCCGAACCCTCCCATCCCCTGT
CCAAAAATTCGACAAATCGCAATTTCTTTGATATCAAGGCGGCCGCGGAGGACATGATGGCTTGTGTAGCATTGT
CTCATTCCGGTTCGATACGGGTGCCGCATCCGACAACAGCTCTCCGGGAGGCGTTGATTGAATTCGAGGGTATTC
TGACGGAGGAGCAAAGGGGACTCTATAAAGTCAGCGCTACGAAACCAGACGTTGCGAGCGTCATCGCATTCGTGA
CGGAGATCGACGCCAACAACAGCACGACAAGGAGATGTGTGGCACCGAGGTTGTGTACATTTCTGGAGGCGACAC
AACAGTTCAGTGATGTCGTGGGTACATTTATCAGCTCCAATCCTCAAATCGCCGCCCTAATCTGGGGCGGCGTTA
AGATGGCTATATTGACGGCAAGCAATATTACATCTTACTTCGACAAGGTCACAAAAATGATTATGGAGATCGGAA
GGTCGTGTCCAACCTATCAACAATTTGGTCAACTTTATCCCGACTGTATCAGCCTTCAACGTGAGCTATGCGAGT
ACTATGCAGCCATCGTCCAATTGTGTACCAAGATCATCGAAGTATCAAGACGCCCGCCGATCACGCAAACTTTAT
CGTCTATTTTCAATCCCTTCGAGTCTGATTTCAAAAGCCCTCTCGATAAACTAAAGCAAGCTACAAAGGACATAC
AGCTGCAGATATCACTTGCCTCAAAGCAGGCTAACGAGGAAACAAAAAAATTGCTGGAAAACGAGAGCCAAAATA
ACGCAGCATCCCGAAAGTTGACAAATAAATTCCGAAAAGAAACCCAAAAGGAACACACTGAGGCGCACCAGTGGA
GAATCCACATGATGAAGAGGGAAGCTGCAAGCTTGAGATCTAGCATTAGACAAAATCTTTCTACCATCGACTACG
TCAAACCCTGGAAGCAAGCTATCCAACAACGCGTGCCCTCCACAGCGGAGTGGCTACTGCAAGAGTTCCTTTTCC
ATGATTGGCAAGATGACCAAAATACTGCAATTCTCTGGTGCCCAGGCACGATGGGTATGGGAAAGACAGTGCTTA
TATCTAATGTGGTTGCCCAACTTCATGCCTCACGAAATACCAATGACATTATTTCCTATTACATTTGTCGTGCGG
ACAACACTGCATCTCTGTCAGCGAGAAACATTATCGGGAGTCTTGCTCGTCAAATATTAGACTCTCAGATCAAAC
ACGCTGAAGATGAAAGTCTACAACGCCTATACGAGGATAGCAATGACCTCAATACGGCTGAAGTAGTTGATTTCG
TACTGTCTCGGCTCCACGATGACAATACATACTATCTAGCTATTGATGGACTGGATGAATGTGAACCTGTCGAGA
TCCGGAAGGTGGCGCAGAGTGTGGCCAAACTTTGTAACATGCGCGTTAAAAACTTCAAAGTTCTCTATACAGGCC
GCCCGGAGCTTGAAAACCAATTGTTTGGAGCCATGAAACCCAAATACAAAATCCCGGTGACCGAGACAAAAGTTG
ACTTGGAGATGGATCGCTATATTGCCGCGGCTATAGGCAACTGCCTAGAAGACAAACAATTGATCTTGGGGGATC
CCACGCTCATTGTGAAGATATTTGAAACCCTAAAAAAGGGATCCAACGGAATGTAAGTGATGAAATGATCCAATT
CAAGCGACGGGATGAGGGGTTTTCCACCATCTTTATCAATCGAGCTAGGCATGAAGTCCTGGTGAATTCTTTATC
ATTAGGAGTGAAAGTTGTTGGACTTTTATGTTGCAAGTATCTAGGCTGATCGATAAAGGTTCCTCTGGACGCGTC
TTTTCATCGAAGAGCTCTGCGAACAAGGCAGTGACAGCGACATCTTAGATGCATTGAAGCATCCCCCTCGTGGCC
TATCTGAAATATTTGACAGAAAACTCAGCCGTGTACGGGAGAGAACCTTGGGAAAAGACGCGTTCAAAATTCTCC
AATTTTGTGGTGTGATGAAGCGGCCATTGACAGCGATGGAATACCAGGAGGTTTTAGGTCTTTTTCCTGGACAAA
TGTCTCTTGACCGAAAAAAGCTCCCCAACGACATGAATAAGGTCATTGGTGATTGTTGTGGTCTAACATTCATCG
ACGAAGAGGACAGCACTGTGCACTATGTTCATCATAGCGTGAAGAAACACCTTTTTGGCACGAACTCCCGACACT
CGGAGGAATTCAATATGGCGGGACTTGATTGGCATATCGGCGTTCTTTGCATGACCTACCTCGATTTCACTGATT
TTAAGCGTCAGTTGACGAAAATTCAGAATGGTTCAAATACTCCTATACGGCCTGTTCAGCTTGGAATGTCCCCCT
TCGGCAGTTACAGCAGTATGACTGGTCGAATGGCACTGAGGCTACTTTCTTACCGTGAGAAGTTACGGCATCTCA
GCGCTGGGGAGCTAGAGAGGAAGGCCCAACAAATACTTGGTGACAAAGAGTCTTCACGTCTAGAGATGGAACTCC
AAAGCCGAGGTTTTCACTTTCTCGAATACGCCCGAAATCACTGGATCAATCACCTCACAAACCCACATCCCGAAT
CTGAGGATATGGCTTGGTCATTGTTCTGCCGATGTGTAGAAGGGAATGATATTGTTGCATACAGACCATGGGAGT
CAGCGCAGAAGGCCTACGAAGATAGAAACGATGTACCGCAGACGATACAATGGTTGTCAGCATATGGACATTATC
ACTTGCTTTTGTACTATATAAGGCGTCAGCCTTATATTTTAACAGAGAACATCAAGCGTCATATACTTCGAAGTT
CCATCACCAATGGCCATCATCGTCTCGCCAGGTGTATTATCCAACACGGACGCGATTCTCCTGCTCTCATGAATC
ATGGATTGTTTTTGGTTTCGAGAGAAGGTTGCAGTGAATTACTACCAAGTCTGCTCCAAGTAGTCACCCACGTGG
ATGCACGAGTGTGTGGCCAAACAGCGCTCCAAGCAGCAGCGCAAGGAGGCCATCTTCAGGTGGTAGAGCGACTTC
TCGCAGCAACGGCAAATGTCAATGCACCCGCCGCAGAGGGAAATGGACGAACAGCGCTCCAGGCAGCAGCGCAAG
GAGGTCATCTCAAGGTCGTGGAGCGACTTCTCGCTGCAACAGCAAATGTCAATGCGCCCGCCGCAGAGGAAAATG
GACGAACAGCCCTTCAAGCAGCAGCGGAAGGAGGCCATCTTCAGGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail