Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6768.t1
Gene name
Locationscaffold_18:460355..461942
Strand-
Gene length (bp)1587
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07519 Tannase Tannase and feruloyl esterase 3.1E-94 74 526

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 6.97 2.66 11.29
5d_25C Five days - 25 degrees Celsius 6.73 2.54 10.92
7d_25C Seven days - 25 degrees Celsius 7.72 3.03 12.41
10d_25C Ten days - 25 degrees Celsius 8.29 3.36 13.21
7d_15C Seven days - 15 degrees Celsius 7.71 3.05 12.38
7d_30C Seven days - 30 degrees Celsius 8.87 3.66 14.08

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.947640 no
3d_25C 7d_25C 0.830618 no
3d_25C 7d_15C 0.833766 no
3d_25C 7d_30C 0.539349 no
3d_25C 10d_25C 0.686099 no
5d_25C 7d_25C 0.767240 no
5d_25C 7d_15C 0.766262 no
5d_25C 7d_30C 0.468993 no
5d_25C 10d_25C 0.608646 no
7d_25C 7d_15C 0.998280 no
7d_25C 7d_30C 0.757973 no
7d_25C 10d_25C 0.887530 no
7d_15C 7d_30C 0.756899 no
7d_15C 10d_25C 0.885104 no
7d_30C 10d_25C 0.888320 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6768.t1
MNMKMAVFSRTLLSLSAIFVEIASASRCSPSLIEKPKLSGTSILDVQAQEALNFSAVSLGPGTNEGGRYTISFCN
VTVTHTHPGWNDTITTQVWLPLEGWNGRFQGLGGGGYATGFGETYLTYAVSRGFASASTNGGLPVANGKDTIPTD
LSWALNSENNVNWFFLEDYASKATNDMAVIGQQITKSYYKKPANYSYFAGCSGGGRQGLLMAQKYPDVFDGILAV
APALDIQRFIPAGFWASQVMNQLGVYPSPCEVNAFTEAAVKACDRLDGVEDGIISSPDHCHVKAADFVGMSYTCD
SIRKTFSASSAEVIQAAWSGSRSISKHDGWYGVNKDAALGTAYVPTACSAKNACYSFGSDLFGNWLKYLVAKDST
FSTSNMTQEEFFKGLRSSNVDYSGMLGTNDPDLSNFKAKGGKMITWQGMADEAIPPLGTIAYYEEVLKNDPKAQD
FYRFFEAPGVGHCYGGPGPIPNGAMSQLVEWVENGHAPVVLHATKGSNNTARDLCPYPLRQKYVGGDSRNATSFT
CTK*
Coding >Pro_DTO377G3_2|g6768.t1
ATGAATATGAAGATGGCGGTCTTCTCCCGCACCTTGCTCTCCCTGAGCGCTATTTTTGTTGAGATAGCGTCCGCT
TCCAGATGTTCGCCAAGCTTGATCGAGAAGCCAAAATTGTCTGGTACTTCAATCCTCGATGTTCAAGCCCAGGAA
GCCCTCAACTTTTCTGCCGTTAGCCTTGGACCAGGGACTAACGAAGGCGGCCGATATACAATCAGCTTCTGCAAT
GTTACCGTTACCCACACACATCCTGGCTGGAATGACACAATTACTACTCAAGTATGGCTCCCACTTGAGGGATGG
AATGGAAGGTTTCAAGGCTTAGGTGGCGGAGGCTACGCTACAGGCTTTGGCGAAACTTACCTAACATACGCTGTG
TCGCGAGGATTCGCATCTGCCTCTACGAATGGAGGCCTACCTGTGGCGAATGGGAAAGATACTATACCTACAGAC
CTGTCATGGGCTCTGAACAGCGAAAACAATGTGAACTGGTTCTTCCTAGAGGATTACGCATCGAAGGCAACGAAC
GACATGGCTGTGATTGGACAGCAGATCACCAAATCCTACTACAAAAAACCCGCAAACTATTCATATTTTGCCGGA
TGCTCTGGTGGTGGAAGGCAGGGCCTCTTGATGGCACAGAAGTACCCGGACGTTTTTGATGGCATTTTAGCCGTC
GCTCCGGCCCTTGATATACAACGTTTCATCCCTGCAGGCTTCTGGGCCTCACAAGTCATGAACCAACTTGGAGTT
TATCCATCGCCCTGTGAGGTCAATGCTTTCACGGAAGCAGCCGTGAAGGCTTGCGATCGACTAGATGGGGTTGAA
GACGGCATCATTAGCTCCCCAGATCACTGTCACGTCAAGGCTGCCGACTTTGTTGGGATGAGCTACACTTGCGAC
AGCATTCGGAAAACCTTCAGTGCTTCCAGCGCGGAAGTTATCCAAGCGGCTTGGTCCGGTTCTCGCTCTATCTCA
AAGCACGATGGCTGGTACGGGGTCAACAAGGATGCAGCGCTCGGCACTGCCTATGTGCCTACCGCATGCTCTGCG
AAAAACGCATGTTACTCTTTTGGAAGCGACTTGTTTGGCAACTGGCTCAAGTATCTTGTTGCTAAGGACTCGACC
TTTTCAACCAGCAATATGACTCAGGAGGAGTTCTTCAAAGGCCTACGCTCTTCAAACGTTGATTATTCAGGGATG
CTAGGAACGAATGACCCTGATCTCTCCAACTTCAAGGCAAAAGGTGGCAAAATGATCACTTGGCAGGGAATGGCA
GACGAAGCTATTCCACCGCTTGGGACTATTGCCTACTATGAGGAAGTGCTGAAGAACGACCCAAAAGCTCAGGAC
TTCTATCGCTTCTTCGAAGCACCTGGTGTTGGTCACTGTTACGGTGGACCCGGGCCTATTCCGAACGGAGCAATG
TCCCAACTGGTTGAATGGGTCGAGAACGGACATGCCCCTGTTGTTCTGCATGCCACCAAAGGTAGCAACAATACA
GCCAGAGACCTTTGCCCATATCCTCTTCGGCAAAAGTACGTTGGAGGAGATTCTAGAAATGCGACCTCTTTCACC
TGCACCAAATAA
Transcript >Pro_DTO377G3_2|g6768.t1
ATGAATATGAAGATGGCGGTCTTCTCCCGCACCTTGCTCTCCCTGAGCGCTATTTTTGTTGAGATAGCGTCCGCT
TCCAGATGTTCGCCAAGCTTGATCGAGAAGCCAAAATTGTCTGGTACTTCAATCCTCGATGTTCAAGCCCAGGAA
GCCCTCAACTTTTCTGCCGTTAGCCTTGGACCAGGGACTAACGAAGGCGGCCGATATACAATCAGCTTCTGCAAT
GTTACCGTTACCCACACACATCCTGGCTGGAATGACACAATTACTACTCAAGTATGGCTCCCACTTGAGGGATGG
AATGGAAGGTTTCAAGGCTTAGGTGGCGGAGGCTACGCTACAGGCTTTGGCGAAACTTACCTAACATACGCTGTG
TCGCGAGGATTCGCATCTGCCTCTACGAATGGAGGCCTACCTGTGGCGAATGGGAAAGATACTATACCTACAGAC
CTGTCATGGGCTCTGAACAGCGAAAACAATGTGAACTGGTTCTTCCTAGAGGATTACGCATCGAAGGCAACGAAC
GACATGGCTGTGATTGGACAGCAGATCACCAAATCCTACTACAAAAAACCCGCAAACTATTCATATTTTGCCGGA
TGCTCTGGTGGTGGAAGGCAGGGCCTCTTGATGGCACAGAAGTACCCGGACGTTTTTGATGGCATTTTAGCCGTC
GCTCCGGCCCTTGATATACAACGTTTCATCCCTGCAGGCTTCTGGGCCTCACAAGTCATGAACCAACTTGGAGTT
TATCCATCGCCCTGTGAGGTCAATGCTTTCACGGAAGCAGCCGTGAAGGCTTGCGATCGACTAGATGGGGTTGAA
GACGGCATCATTAGCTCCCCAGATCACTGTCACGTCAAGGCTGCCGACTTTGTTGGGATGAGCTACACTTGCGAC
AGCATTCGGAAAACCTTCAGTGCTTCCAGCGCGGAAGTTATCCAAGCGGCTTGGTCCGGTTCTCGCTCTATCTCA
AAGCACGATGGCTGGTACGGGGTCAACAAGGATGCAGCGCTCGGCACTGCCTATGTGCCTACCGCATGCTCTGCG
AAAAACGCATGTTACTCTTTTGGAAGCGACTTGTTTGGCAACTGGCTCAAGTATCTTGTTGCTAAGGACTCGACC
TTTTCAACCAGCAATATGACTCAGGAGGAGTTCTTCAAAGGCCTACGCTCTTCAAACGTTGATTATTCAGGGATG
CTAGGAACGAATGACCCTGATCTCTCCAACTTCAAGGCAAAAGGTGGCAAAATGATCACTTGGCAGGGAATGGCA
GACGAAGCTATTCCACCGCTTGGGACTATTGCCTACTATGAGGAAGTGCTGAAGAACGACCCAAAAGCTCAGGAC
TTCTATCGCTTCTTCGAAGCACCTGGTGTTGGTCACTGTTACGGTGGACCCGGGCCTATTCCGAACGGAGCAATG
TCCCAACTGGTTGAATGGGTCGAGAACGGACATGCCCCTGTTGTTCTGCATGCCACCAAAGGTAGCAACAATACA
GCCAGAGACCTTTGCCCATATCCTCTTCGGCAAAAGTACGTTGGAGGAGATTCTAGAAATGCGACCTCTTTCACC
TGCACCAAATAA
Gene >Pro_DTO377G3_2|g6768.t1
ATGAATATGAAGATGGCGGTCTTCTCCCGCACCTTGCTCTCCCTGAGCGCTATTTTTGTTGAGATAGCGTCCGCT
TCCAGATGTTCGCCAAGCTTGATCGAGAAGCCAAAATTGTCTGGTACTTCAATCCTCGATGTTCAAGCCCAGGAA
GCCCTCAACTTTTCTGCCGTTAGCCTTGGACCAGGGACTAACGAAGGCGGCCGATATACAATCAGCTTCTGCAAT
GTTACCGTTACCCACACACATCCTGGCTGGAATGACACAATTACTACTCAAGTATGGCTCCCACTTGAGGGATGG
AATGGAAGGTTTCAAGGCTTAGGTGGCGGAGGCTACGCTACAGGCTTTGGCGAAACTTACCTAACATACGCTGTG
TCGCGAGGATTCGCATCTGCCTCTACGAATGGAGGCCTACCTGTGGCGAATGGGAAAGATACTATACCTACAGAC
CTGTCATGGGCTCTGAACAGCGAAAACAATGTGAACTGGTTCTTCCTAGAGGATTACGCATCGAAGGCAACGAAC
GACATGGCTGTGATTGGACAGCAGATCACCAAATCCTACTACAAAAAACCCGCAAACTATTCATATTTTGCCGGA
TGCTCTGGTGGTGGAAGGCAGGGCCTCTTGATGGCACAGAAGTACCCGGACGTTTTTGATGGCATTTTAGCCGTC
GCTCCGGCCCTTGATATACAACGTTTCATCCCTGCAGGCTTCTGGGCCTCACAAGTCATGAACCAACTTGGAGTT
TATCCATCGCCCTGTGAGGTCAATGCTTTCACGGAAGCAGCCGTGAAGGCTTGCGATCGACTAGATGGGGTTGAA
GACGGCATCATTAGCTCCCCAGATCACTGTCACGTCAAGGCTGCCGACTTTGTTGGGATGAGCTACACTTGCGAC
AGCATTCGGAAAACCTTCAGTGCTTCCAGCGCGGAAGTTATCCAAGCGGCTTGGTCCGGTTCTCGCTCTATCTCA
AAGCACGATGGCTGGTACGGGGTCAACAAGGATGCAGCGCTCGGCACTGCCTATGTGCCTACCGCATGCTCTGCG
AAAAACGCATGTTACTCTTTTGGAAGCGACTTGTTTGGCAACTGGCTCAAGTATCTTGTTGCTAAGGACTCGACC
TTTTCAACCAGCAATATGACTCAGGAGGAGTTCTTCAAAGGCCTACGCTCTTCAAACGTTGATTATTCAGGGATG
CTAGGAACGAATGACCCTGATCTCTCCAACTTCAAGGCAAAAGGTGGCAAAATGATCACTTGGCAGGGAATGGCA
GACGAAGCTATTCCACCGCTTGGGACTATTGCCTACTATGAGGAAGTGCTGAAGAACGACCCAAAAGCTCAGGAC
TTCTATCGCTTCTTCGAAGCACCTGGTGTTGGTCACTGTTACGGTGGACCCGGGCCTATTCCGAACGGAGCAATG
TCCCAACTGGTTGAATGGGTCGAGAACGGACATGCCCCTGTTGTTCTGCATGCCACCAAAGGTAGCAACAATACA
GCCAGAGACCTTTGCCCATATCCTCTTCGGCAAAAGTACGTTGGAGGAGATTCTAGAAATGCGACCTCTTTCACC
TGCACCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail