Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6762.t1
Gene name
Locationscaffold_18:432749..437731
Strand-
Gene length (bp)4982
Transcript length (bp)4845
Coding sequence length (bp)4845
Protein length (aa) 1615

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 4.4E-59 126 482
PF00132 Hexapep Bacterial transferase hexapeptide (six repeats) 2.4E-05 1234 1267
PF00550 PP-binding Phosphopantetheine attachment site 2.0E-10 722 786

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 1112 1134 22
2 1369 1391 22
3 1421 1443 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6762.t1
MADLSRSSLIEQLLHLRSEASHPDSCRQLSALLSLHTGSWPIRHLILTFQDIYKSIPESIKANNNESITYLRAQV
KAATPSVAELIGTDSRAGLIDANTGRHLTHIAIRQFLESFQLPVGLSRHGKPRIAVILPNGPLMAVAVLAFVNRY
TIVPMTTNTVPEQLQTDIENSQADAVVALDADIGKLQLNNGSRPVFGIEQLEDMTFRVVSAHNASGAYNHPPNSG
DDIAIILFTSGTSGTKKLVPITTYNLIAGTMATIESVELSETDICLNMMPLNHVGGIMRSIFSPVLAGGATICCP
SFDPSMFWDAVQTPHMTPTWYYATPTMHQMILAEAEHRPDAVKQSAIQFICNAGGGLPPTLAVQLHDIFHCAVLP
SYGMTECMPIAAPPRSYKLDRHGTSGKIVGPEVAILTESGEPVQQNGMLGHICIRGSPAFEGYLTPGGKIDTSAF
NESGWFDTGDLGHLDDDNYLYITGRSKEVINRGGEIISPVEVENAILTTAKDPESPLYGRVTETLAFSVPDEVLQ
EVVGVVIVTPPGFTRPDLRQIHEALQPILHQPKWPALVVYMDGVPKANNKIQRIKLAERLSLDILTTATPLASRH
YEAVCPPTGAPLSASISKNLCVIDDKIIRSVLTKRANTPDMHVQINPRDGLAQVILFVQNPDDDHVTPGELHDHL
HGYLVPSRIIPLKGPMPLDFYGNPDSAAINEAILARNSDGNLSPIQQRVREIFAVALSCAPEEVSRLTDFFAAGG
DSLSAGRMVSQLRREFAIFLAGDILFHHSTVGEIEHKIIEAVEVKAAKGDDGEVDLPGCEKTYSSTNPIILLLHL
LPTVFFFPMKRAFQWIMFAYVVAECSNRFPIRENLFARLMLVVFAVMSARLCSQIVSPIFAIIFKWLVIGRYKEG
MSPMWGPYHTRWWLTQKVLQVCGKGLFNNYNWSRILFYRLIGAKIGKNVTMSASAKLGEYDLIEIGDNVVLDTCM
CRPFGVERNTSMLLKRIRIGKDSSIGIKSVIAPGADIPERTCIGPNSSSWELRDADESNRQLLTSQIPKPHWIWI
LFIVEPIKLITWTAARITWMAALLPMVLEFPTPAADMFRSTLEWYTSDQRIAFHITARICRAVGGPIVLFIAVLI
IKFFLDLICGKPRPGPASKQTTRQKIRSAVLAQILPAGDIHGLTRLTGRHYEFVSMAVRALGGKVGKHVYWPSVG
PVTVDFDLIEVGNDVVFGSRSTLVTSDGYGRDRIVIGDGTMVGDRVVALPGATIGRQAMIGSGALLRRNGDYPAN
SVWTGSKGGEAIQFPSSTSTSTSTAPTIIGDGGSSPNTSGSEDEKTPTEKQTYCGTKDKAVTEIAEQEVDTCKPF
GRAFYRHEANYYVLRMWQIVIYSTFAVIFTTVYWLLTVLFSLFVLRSVLSYSDAAGFKQGAWRPFVLYGTLASIL
SVITTVQVALAFGIILCIKWTVVGRRKEGSYHWDKSSYNQRWQFLLSCETLIKDCYDGVGLLPMISGSAYISWYY
RLLGANIGKDCAIHANGSPSIFFTEPDLLTLGDRVAVDDASLVCHLNSRGGFELHTLNVGDRSILRAGSRLMSGA
SMGQDACLLEHTLVLSGDHVENGDTLQGWPAEGFDGKRV*
Coding >Pro_DTO377G3_2|g6762.t1
ATGGCAGACTTATCAAGATCTTCACTTATAGAACAGCTTTTACACCTCCGCAGTGAGGCCTCTCATCCAGACTCT
TGCCGTCAACTCTCCGCTCTATTATCCCTACACACCGGCTCTTGGCCCATCCGTCACCTAATCCTAACATTTCAG
GACATTTACAAGTCCATTCCCGAATCCATCAAGGCCAACAACAATGAATCAATTACCTACCTCCGTGCACAAGTC
AAAGCAGCCACCCCCAGCGTTGCGGAATTAATAGGGACAGACTCCCGCGCCGGTCTCATCGATGCTAACACCGGA
CGGCATCTGACACATATTGCCATACGGCAGTTCTTGGAGAGTTTCCAGCTTCCCGTGGGACTCTCCCGTCATGGA
AAGCCTCGCATCGCTGTCATCTTGCCTAACGGCCCTCTGATGGCAGTCGCTGTTCTTGCTTTCGTCAACAGGTAC
ACCATTGTGCCTATGACAACGAACACGGTGCCAGAGCAATTACAGACAGATATAGAAAACTCGCAAGCTGATGCT
GTTGTCGCGCTGGACGCTGACATTGGCAAGCTGCAGCTGAACAATGGCAGTCGGCCAGTGTTTGGTATTGAGCAA
CTTGAAGACATGACTTTCCGGGTGGTCTCTGCGCACAATGCTTCTGGTGCATACAACCATCCCCCCAATTCTGGG
GACGATATCGCCATTATCTTGTTCACTAGTGGTACTAGTGGTACTAAGAAGCTGGTTCCCATCACAACTTACAAC
CTCATCGCGGGTACCATGGCTACCATAGAGTCAGTCGAACTGTCCGAGACAGATATCTGTCTTAATATGATGCCT
CTGAACCATGTTGGTGGCATCATGCGAAGTATCTTCTCACCCGTACTCGCCGGCGGTGCCACAATATGTTGCCCC
TCGTTTGACCCCAGCATGTTCTGGGATGCCGTGCAAACTCCTCATATGACACCAACTTGGTACTATGCTACACCT
ACAATGCACCAGATGATTCTTGCTGAAGCTGAGCACCGCCCCGATGCTGTCAAGCAAAGTGCCATCCAGTTTATC
TGCAACGCTGGTGGTGGTCTCCCTCCAACACTTGCCGTGCAGCTCCATGATATTTTCCACTGCGCCGTCCTCCCC
AGTTACGGTATGACTGAATGTATGCCTATTGCCGCGCCACCGAGGAGCTACAAGCTTGATCGCCATGGAACATCG
GGAAAGATCGTCGGTCCTGAGGTTGCAATTCTGACCGAGAGTGGCGAGCCTGTCCAGCAAAATGGGATGCTAGGA
CACATCTGCATTCGTGGATCACCCGCTTTTGAAGGGTATCTGACCCCTGGAGGCAAGATTGACACCAGTGCATTC
AACGAATCCGGCTGGTTTGATACTGGTGATCTTGGACACCTCGACGATGACAACTACCTGTACATCACTGGCCGC
AGCAAGGAGGTCATCAACCGTGGTGGTGAAATTATCTCTCCCGTCGAAGTGGAAAATGCAATCCTGACCACAGCC
AAGGATCCTGAATCCCCGCTGTATGGTCGTGTTACTGAGACGTTAGCCTTTTCTGTCCCAGACGAGGTACTGCAA
GAAGTTGTCGGTGTGGTTATTGTCACACCTCCGGGCTTCACTAGGCCGGATCTTCGCCAGATACACGAAGCACTG
CAGCCTATTCTCCACCAGCCTAAGTGGCCCGCTCTGGTAGTATACATGGACGGCGTGCCCAAGGCAAACAACAAA
ATCCAGCGGATCAAGCTCGCAGAGCGGCTGTCCCTGGATATCTTGACCACGGCCACACCCCTGGCAAGCAGGCAC
TACGAAGCTGTCTGCCCACCTACTGGCGCTCCACTCAGCGCATCAATCTCGAAGAACTTGTGTGTCATCGATGAT
AAAATAATCCGCTCAGTTCTCACCAAGAGAGCAAATACCCCTGACATGCACGTGCAAATAAACCCGCGCGATGGG
CTCGCACAGGTTATTTTGTTTGTCCAGAACCCAGATGATGACCATGTGACACCTGGCGAGCTCCACGACCACCTC
CATGGCTATCTCGTACCTAGCCGTATCATTCCACTCAAAGGTCCCATGCCTCTCGACTTCTACGGAAACCCCGAC
TCGGCCGCGATCAATGAGGCCATCCTTGCCCGCAACTCGGATGGTAACCTGTCGCCCATTCAGCAGCGCGTACGT
GAGATTTTCGCTGTGGCCTTGTCTTGTGCACCAGAGGAAGTATCTCGTCTTACCGACTTTTTTGCTGCTGGAGGT
GATAGTCTTAGTGCTGGTCGAATGGTTTCGCAACTTCGTCGCGAATTCGCTATTTTCCTGGCCGGTGACATTCTC
TTCCACCACAGCACTGTTGGAGAGATAGAGCACAAGATCATTGAAGCTGTTGAAGTTAAGGCTGCCAAGGGCGAC
GATGGAGAAGTTGACTTGCCCGGTTGTGAGAAGACATACAGCAGCACGAACCCAATTATCTTGCTCCTACACCTG
TTACCGACTGTGTTCTTTTTCCCCATGAAACGCGCCTTCCAATGGATCATGTTCGCATATGTCGTGGCTGAGTGC
TCTAATCGATTTCCCATTCGTGAGAACCTCTTCGCTCGTTTGATGCTGGTTGTTTTTGCCGTGATGTCTGCTCGC
TTATGTTCACAAATTGTGTCTCCCATCTTTGCTATCATCTTTAAGTGGCTCGTCATCGGTCGCTACAAGGAGGGC
ATGTCACCCATGTGGGGCCCGTACCATACGCGCTGGTGGTTGACCCAGAAGGTATTGCAGGTGTGTGGAAAGGGA
CTCTTCAACAACTACAACTGGTCCCGCATTCTCTTCTACCGTTTAATCGGCGCAAAGATTGGCAAAAATGTTACC
ATGTCCGCGTCCGCTAAGCTCGGCGAGTATGATCTTATTGAGATTGGCGATAATGTCGTTTTGGATACCTGCATG
TGTCGCCCCTTCGGCGTGGAGCGCAATACCTCTATGCTTTTGAAGCGCATTCGCATTGGCAAAGACTCGTCGATA
GGGATCAAGTCTGTCATCGCCCCTGGTGCTGACATCCCGGAGAGGACCTGCATTGGTCCCAACTCGTCGAGCTGG
GAACTTCGGGACGCCGATGAGTCTAACCGCCAATTGCTGACCTCCCAGATCCCCAAGCCTCATTGGATCTGGATT
CTCTTTATTGTTGAGCCAATCAAGTTGATCACCTGGACAGCTGCTCGTATTACCTGGATGGCCGCTCTTCTTCCT
ATGGTTCTCGAGTTCCCTACTCCTGCGGCAGACATGTTCCGGTCTACCCTAGAATGGTACACCAGTGATCAGCGG
ATTGCGTTCCACATCACCGCAAGGATCTGTCGTGCTGTTGGTGGCCCGATTGTGCTTTTTATTGCAGTCTTGATC
ATCAAGTTCTTCCTCGATCTCATCTGTGGCAAGCCCAGACCTGGTCCTGCCTCAAAACAGACCACTCGCCAAAAG
ATTCGGAGTGCGGTGCTTGCGCAGATTCTGCCCGCAGGTGACATCCACGGACTCACCCGCCTTACTGGTCGTCAC
TACGAATTTGTTTCAATGGCTGTCCGTGCCCTTGGTGGCAAGGTTGGCAAGCATGTCTACTGGCCTAGTGTTGGT
CCCGTCACTGTCGACTTTGATCTCATTGAGGTTGGTAACGATGTTGTTTTTGGTTCTCGCTCGACTCTGGTCACA
TCTGATGGCTACGGCCGTGATCGCATCGTGATCGGTGATGGCACCATGGTTGGTGATCGTGTCGTCGCTTTGCCC
GGTGCTACCATCGGCCGTCAAGCAATGATAGGCTCCGGTGCTTTGCTTCGCCGGAATGGGGACTACCCTGCCAAC
AGTGTCTGGACTGGTAGCAAGGGTGGTGAAGCTATACAGTTCCCAAGTTCCACCTCGACCTCCACTTCGACCGCT
CCAACCATCATCGGAGATGGTGGCAGCAGCCCCAACACTAGCGGCAGCGAAGACGAGAAAACACCGACCGAAAAG
CAGACCTACTGTGGAACTAAAGACAAGGCTGTTACCGAGATCGCTGAGCAGGAAGTGGATACATGCAAGCCTTTC
GGTCGCGCCTTCTACCGCCACGAGGCCAACTACTACGTCCTCCGCATGTGGCAAATTGTCATCTATTCCACTTTT
GCAGTTATTTTCACTACTGTGTATTGGCTTCTCACCGTCTTGTTCTCCCTTTTCGTTCTCCGCAGTGTCCTAAGC
TACAGTGATGCTGCTGGTTTCAAGCAAGGCGCCTGGCGCCCATTCGTTCTGTACGGCACGCTCGCCTCGATCCTA
TCTGTCATCACCACCGTTCAAGTCGCCCTTGCCTTCGGCATTATTCTCTGCATCAAATGGACGGTCGTGGGCCGT
CGCAAGGAAGGCTCCTACCACTGGGACAAGAGCAGCTACAACCAGCGCTGGCAATTCCTCCTTTCCTGCGAAACG
TTGATCAAAGACTGCTATGACGGAGTTGGTCTCCTGCCCATGATCTCTGGCTCTGCCTACATTTCCTGGTACTAC
CGCCTCTTGGGTGCGAACATTGGAAAGGACTGTGCGATACACGCCAACGGTAGTCCCAGCATCTTTTTCACCGAG
CCGGACCTCCTTACCCTTGGTGACCGTGTTGCTGTCGATGATGCCAGTTTGGTCTGCCACTTGAACTCCCGTGGT
GGATTCGAGCTGCATACCTTGAACGTTGGGGATCGGAGTATCCTGCGCGCTGGATCGCGCTTGATGTCTGGTGCT
TCGATGGGCCAGGATGCTTGTCTTTTAGAGCATACTCTGGTCCTGTCCGGAGACCATGTTGAGAATGGAGATACG
CTCCAGGGATGGCCGGCCGAAGGATTTGACGGGAAACGTGTTTAG
Transcript >Pro_DTO377G3_2|g6762.t1
ATGGCAGACTTATCAAGATCTTCACTTATAGAACAGCTTTTACACCTCCGCAGTGAGGCCTCTCATCCAGACTCT
TGCCGTCAACTCTCCGCTCTATTATCCCTACACACCGGCTCTTGGCCCATCCGTCACCTAATCCTAACATTTCAG
GACATTTACAAGTCCATTCCCGAATCCATCAAGGCCAACAACAATGAATCAATTACCTACCTCCGTGCACAAGTC
AAAGCAGCCACCCCCAGCGTTGCGGAATTAATAGGGACAGACTCCCGCGCCGGTCTCATCGATGCTAACACCGGA
CGGCATCTGACACATATTGCCATACGGCAGTTCTTGGAGAGTTTCCAGCTTCCCGTGGGACTCTCCCGTCATGGA
AAGCCTCGCATCGCTGTCATCTTGCCTAACGGCCCTCTGATGGCAGTCGCTGTTCTTGCTTTCGTCAACAGGTAC
ACCATTGTGCCTATGACAACGAACACGGTGCCAGAGCAATTACAGACAGATATAGAAAACTCGCAAGCTGATGCT
GTTGTCGCGCTGGACGCTGACATTGGCAAGCTGCAGCTGAACAATGGCAGTCGGCCAGTGTTTGGTATTGAGCAA
CTTGAAGACATGACTTTCCGGGTGGTCTCTGCGCACAATGCTTCTGGTGCATACAACCATCCCCCCAATTCTGGG
GACGATATCGCCATTATCTTGTTCACTAGTGGTACTAGTGGTACTAAGAAGCTGGTTCCCATCACAACTTACAAC
CTCATCGCGGGTACCATGGCTACCATAGAGTCAGTCGAACTGTCCGAGACAGATATCTGTCTTAATATGATGCCT
CTGAACCATGTTGGTGGCATCATGCGAAGTATCTTCTCACCCGTACTCGCCGGCGGTGCCACAATATGTTGCCCC
TCGTTTGACCCCAGCATGTTCTGGGATGCCGTGCAAACTCCTCATATGACACCAACTTGGTACTATGCTACACCT
ACAATGCACCAGATGATTCTTGCTGAAGCTGAGCACCGCCCCGATGCTGTCAAGCAAAGTGCCATCCAGTTTATC
TGCAACGCTGGTGGTGGTCTCCCTCCAACACTTGCCGTGCAGCTCCATGATATTTTCCACTGCGCCGTCCTCCCC
AGTTACGGTATGACTGAATGTATGCCTATTGCCGCGCCACCGAGGAGCTACAAGCTTGATCGCCATGGAACATCG
GGAAAGATCGTCGGTCCTGAGGTTGCAATTCTGACCGAGAGTGGCGAGCCTGTCCAGCAAAATGGGATGCTAGGA
CACATCTGCATTCGTGGATCACCCGCTTTTGAAGGGTATCTGACCCCTGGAGGCAAGATTGACACCAGTGCATTC
AACGAATCCGGCTGGTTTGATACTGGTGATCTTGGACACCTCGACGATGACAACTACCTGTACATCACTGGCCGC
AGCAAGGAGGTCATCAACCGTGGTGGTGAAATTATCTCTCCCGTCGAAGTGGAAAATGCAATCCTGACCACAGCC
AAGGATCCTGAATCCCCGCTGTATGGTCGTGTTACTGAGACGTTAGCCTTTTCTGTCCCAGACGAGGTACTGCAA
GAAGTTGTCGGTGTGGTTATTGTCACACCTCCGGGCTTCACTAGGCCGGATCTTCGCCAGATACACGAAGCACTG
CAGCCTATTCTCCACCAGCCTAAGTGGCCCGCTCTGGTAGTATACATGGACGGCGTGCCCAAGGCAAACAACAAA
ATCCAGCGGATCAAGCTCGCAGAGCGGCTGTCCCTGGATATCTTGACCACGGCCACACCCCTGGCAAGCAGGCAC
TACGAAGCTGTCTGCCCACCTACTGGCGCTCCACTCAGCGCATCAATCTCGAAGAACTTGTGTGTCATCGATGAT
AAAATAATCCGCTCAGTTCTCACCAAGAGAGCAAATACCCCTGACATGCACGTGCAAATAAACCCGCGCGATGGG
CTCGCACAGGTTATTTTGTTTGTCCAGAACCCAGATGATGACCATGTGACACCTGGCGAGCTCCACGACCACCTC
CATGGCTATCTCGTACCTAGCCGTATCATTCCACTCAAAGGTCCCATGCCTCTCGACTTCTACGGAAACCCCGAC
TCGGCCGCGATCAATGAGGCCATCCTTGCCCGCAACTCGGATGGTAACCTGTCGCCCATTCAGCAGCGCGTACGT
GAGATTTTCGCTGTGGCCTTGTCTTGTGCACCAGAGGAAGTATCTCGTCTTACCGACTTTTTTGCTGCTGGAGGT
GATAGTCTTAGTGCTGGTCGAATGGTTTCGCAACTTCGTCGCGAATTCGCTATTTTCCTGGCCGGTGACATTCTC
TTCCACCACAGCACTGTTGGAGAGATAGAGCACAAGATCATTGAAGCTGTTGAAGTTAAGGCTGCCAAGGGCGAC
GATGGAGAAGTTGACTTGCCCGGTTGTGAGAAGACATACAGCAGCACGAACCCAATTATCTTGCTCCTACACCTG
TTACCGACTGTGTTCTTTTTCCCCATGAAACGCGCCTTCCAATGGATCATGTTCGCATATGTCGTGGCTGAGTGC
TCTAATCGATTTCCCATTCGTGAGAACCTCTTCGCTCGTTTGATGCTGGTTGTTTTTGCCGTGATGTCTGCTCGC
TTATGTTCACAAATTGTGTCTCCCATCTTTGCTATCATCTTTAAGTGGCTCGTCATCGGTCGCTACAAGGAGGGC
ATGTCACCCATGTGGGGCCCGTACCATACGCGCTGGTGGTTGACCCAGAAGGTATTGCAGGTGTGTGGAAAGGGA
CTCTTCAACAACTACAACTGGTCCCGCATTCTCTTCTACCGTTTAATCGGCGCAAAGATTGGCAAAAATGTTACC
ATGTCCGCGTCCGCTAAGCTCGGCGAGTATGATCTTATTGAGATTGGCGATAATGTCGTTTTGGATACCTGCATG
TGTCGCCCCTTCGGCGTGGAGCGCAATACCTCTATGCTTTTGAAGCGCATTCGCATTGGCAAAGACTCGTCGATA
GGGATCAAGTCTGTCATCGCCCCTGGTGCTGACATCCCGGAGAGGACCTGCATTGGTCCCAACTCGTCGAGCTGG
GAACTTCGGGACGCCGATGAGTCTAACCGCCAATTGCTGACCTCCCAGATCCCCAAGCCTCATTGGATCTGGATT
CTCTTTATTGTTGAGCCAATCAAGTTGATCACCTGGACAGCTGCTCGTATTACCTGGATGGCCGCTCTTCTTCCT
ATGGTTCTCGAGTTCCCTACTCCTGCGGCAGACATGTTCCGGTCTACCCTAGAATGGTACACCAGTGATCAGCGG
ATTGCGTTCCACATCACCGCAAGGATCTGTCGTGCTGTTGGTGGCCCGATTGTGCTTTTTATTGCAGTCTTGATC
ATCAAGTTCTTCCTCGATCTCATCTGTGGCAAGCCCAGACCTGGTCCTGCCTCAAAACAGACCACTCGCCAAAAG
ATTCGGAGTGCGGTGCTTGCGCAGATTCTGCCCGCAGGTGACATCCACGGACTCACCCGCCTTACTGGTCGTCAC
TACGAATTTGTTTCAATGGCTGTCCGTGCCCTTGGTGGCAAGGTTGGCAAGCATGTCTACTGGCCTAGTGTTGGT
CCCGTCACTGTCGACTTTGATCTCATTGAGGTTGGTAACGATGTTGTTTTTGGTTCTCGCTCGACTCTGGTCACA
TCTGATGGCTACGGCCGTGATCGCATCGTGATCGGTGATGGCACCATGGTTGGTGATCGTGTCGTCGCTTTGCCC
GGTGCTACCATCGGCCGTCAAGCAATGATAGGCTCCGGTGCTTTGCTTCGCCGGAATGGGGACTACCCTGCCAAC
AGTGTCTGGACTGGTAGCAAGGGTGGTGAAGCTATACAGTTCCCAAGTTCCACCTCGACCTCCACTTCGACCGCT
CCAACCATCATCGGAGATGGTGGCAGCAGCCCCAACACTAGCGGCAGCGAAGACGAGAAAACACCGACCGAAAAG
CAGACCTACTGTGGAACTAAAGACAAGGCTGTTACCGAGATCGCTGAGCAGGAAGTGGATACATGCAAGCCTTTC
GGTCGCGCCTTCTACCGCCACGAGGCCAACTACTACGTCCTCCGCATGTGGCAAATTGTCATCTATTCCACTTTT
GCAGTTATTTTCACTACTGTGTATTGGCTTCTCACCGTCTTGTTCTCCCTTTTCGTTCTCCGCAGTGTCCTAAGC
TACAGTGATGCTGCTGGTTTCAAGCAAGGCGCCTGGCGCCCATTCGTTCTGTACGGCACGCTCGCCTCGATCCTA
TCTGTCATCACCACCGTTCAAGTCGCCCTTGCCTTCGGCATTATTCTCTGCATCAAATGGACGGTCGTGGGCCGT
CGCAAGGAAGGCTCCTACCACTGGGACAAGAGCAGCTACAACCAGCGCTGGCAATTCCTCCTTTCCTGCGAAACG
TTGATCAAAGACTGCTATGACGGAGTTGGTCTCCTGCCCATGATCTCTGGCTCTGCCTACATTTCCTGGTACTAC
CGCCTCTTGGGTGCGAACATTGGAAAGGACTGTGCGATACACGCCAACGGTAGTCCCAGCATCTTTTTCACCGAG
CCGGACCTCCTTACCCTTGGTGACCGTGTTGCTGTCGATGATGCCAGTTTGGTCTGCCACTTGAACTCCCGTGGT
GGATTCGAGCTGCATACCTTGAACGTTGGGGATCGGAGTATCCTGCGCGCTGGATCGCGCTTGATGTCTGGTGCT
TCGATGGGCCAGGATGCTTGTCTTTTAGAGCATACTCTGGTCCTGTCCGGAGACCATGTTGAGAATGGAGATACG
CTCCAGGGATGGCCGGCCGAAGGATTTGACGGGAAACGTGTTTAG
Gene >Pro_DTO377G3_2|g6762.t1
ATGGCAGACTTATCAAGATCTTCGTATGTTTTGTGACATTTATCATGATCTTTTTTCCACCCCTTTTTGGATGTC
CTATTGAAGTTTCTTCCAATTCTGACCGTCATACAGACTTATAGAACAGCTTTTACACCTCCGCAGTGAGGCCTC
TCATCCAGACTCTTGCCGTCAACTCTCCGCTCTATTATCCCTACACACCGGCTCTTGGCCCATCCGTCACCTAAT
CCTAACATTTCAGGACATTTACAAGTCCATTCCCGAATCCATCAAGGCCAACAACAATGAATCAATTACCTACCT
CCGTGCACAAGTCAAAGCAGCCACCCCCAGCGTTGCGGAATTAATAGGGACAGACTCCCGCGCCGGTCTCATCGA
TGCTAACACCGGACGGCATCTGACACATATTGCCATACGGCAGTTCTTGGAGAGTTTCCAGCTTCCCGTGGGACT
CTCCCGTCATGGAAAGCCTCGCATCGCTGTCATCTTGCCTAACGGCCCTCTGATGGCAGTCGCTGTTCTTGCTTT
CGTCAACAGGTACACCATTGTGCCTATGACAACGAACACGGTGCCAGAGCAATTACAGACAGATATAGAAAACTC
GCAAGCTGATGCTGTTGTCGCGCTGGACGCTGACATTGGCAAGCTGCAGCTGAACAATGGCAGTCGGCCAGTGTT
TGGTATTGAGCAACTTGAAGACATGACTTTCCGGGTGGTCTCTGCGCACAATGCTTCTGGTGCATACAACCATCC
CCCCAATTCTGGGGACGATATCGCCATTATCTTGTTCACTAGTGGTACTAGTGGTACTAAGAAGCTGGTTCCCAT
CACAACTTACAACCTCATCGCGGGTACCATGGCTACCATAGAGTCAGTCGAACTGTCCGAGACAGATATCTGTCT
TAATATGATGCCTCTGAACCATGTGTATGTTCCCTGCCAAATTAAATTATAGGAAGACAGCTAACATTATCAGTG
GTGGCATCATGCGAAGTATCTTCTCACCCGTACTCGCCGGCGGTGCCACAATATGTTGCCCCTCGTTTGACCCCA
GCATGTTCTGGGATGCCGTGCAAACTCCTCATATGACACCAACTTGGTACTATGCTACACCTACAATGCACCAGA
TGATTCTTGCTGAAGCTGAGCACCGCCCCGATGCTGTCAAGCAAAGTGCCATCCAGTTTATCTGCAACGCTGGTG
GTGGTCTCCCTCCAACACTTGCCGTGCAGCTCCATGATATTTTCCACTGCGCCGTCCTCCCCAGTTACGGTATGA
CTGAATGTATGCCTATTGCCGCGCCACCGAGGAGCTACAAGCTTGATCGCCATGGAACATCGGGAAAGATCGTCG
GTCCTGAGGTTGCAATTCTGACCGAGAGTGGCGAGCCTGTCCAGCAAAATGGGATGCTAGGACACATCTGCATTC
GTGGATCACCCGCTTTTGAAGGGTATCTGACCCCTGGAGGCAAGATTGACACCAGTGCATTCAACGAATCCGGCT
GGTTTGATACTGGTGATCTTGGACACCTCGACGATGACAACTACCTGTACATCACTGGCCGCAGCAAGGAGGTCA
TCAACCGTGGTGGTGAAATTATCTCTCCCGTCGAAGTGGAAAATGCAATCCTGACCACAGCCAAGGATCCTGAAT
CCCCGCTGTATGGTCGTGTTACTGAGACGTTAGCCTTTTCTGTCCCAGACGAGGTACTGCAAGAAGTTGTCGGTG
TGGTTATTGTCACACCTCCGGGCTTCACTAGGCCGGATCTTCGCCAGATACACGAAGCACTGCAGCCTATTCTCC
ACCAGCCTAAGTGGCCCGCTCTGGTAGTATACATGGACGGCGTGCCCAAGGCAAACAACAAAATCCAGCGGATCA
AGCTCGCAGAGCGGCTGTCCCTGGATATCTTGACCACGGCCACACCCCTGGCAAGCAGGCACTACGAAGCTGTCT
GCCCACCTACTGGCGCTCCACTCAGCGCATCAATCTCGAAGAACTTGTGTGTCATCGATGATAAAATAATCCGCT
CAGTTCTCACCAAGAGAGCAAATACCCCTGACATGCACGTGCAAATAAACCCGCGCGATGGGCTCGCACAGGTTA
TTTTGTTTGTCCAGAACCCAGATGATGACCATGTGACACCTGGCGAGCTCCACGACCACCTCCATGGCTATCTCG
TACCTAGCCGTATCATTCCACTCAAAGGTCCCATGCCTCTCGACTTCTACGGAAACCCCGACTCGGCCGCGATCA
ATGAGGCCATCCTTGCCCGCAACTCGGATGGTAACCTGTCGCCCATTCAGCAGCGCGTACGTGAGATTTTCGCTG
TGGCCTTGTCTTGTGCACCAGAGGAAGTATCTCGTCTTACCGACTTTTTTGCTGCTGGAGGTGATAGTCTTAGTG
CTGGTCGAATGGTTTCGCAACTTCGTCGCGAATTCGCTATTTTCCTGGCCGGTGACATTCTCTTCCACCACAGCA
CTGTTGGAGAGATAGAGCACAAGATCATTGAAGCTGTTGAAGTTAAGGCTGCCAAGGGCGACGATGGAGAAGTTG
ACTTGCCCGGTTGTGAGAAGACATACAGCAGCACGAACCCAATTATCTTGCTCCTACACCTGTTACCGACTGTGT
TCTTTTTCCCCATGAAACGCGCCTTCCAATGGATCATGTTCGCATATGTCGTGGCTGAGTGCTCTAATCGATTTC
CCATTCGTGAGAACCTCTTCGCTCGTTTGATGCTGGTTGTTTTTGCCGTGATGTCTGCTCGCTTATGTTCACAAA
TTGTGTCTCCCATCTTTGCTATCATCTTTAAGTGGCTCGTCATCGGTCGCTACAAGGAGGGCATGTCACCCATGT
GGGGCCCGTACCATACGCGCTGGTGGTTGACCCAGAAGGTATTGCAGGTGTGTGGAAAGGGACTCTTCAACAACT
ACAACTGGTCCCGCATTCTCTTCTACCGTTTAATCGGCGCAAAGATTGGCAAAAATGTTACCATGTCCGCGTCCG
CTAAGCTCGGCGAGTATGATCTTATTGAGATTGGCGATAATGTCGTTTTGGATACCTGCATGTGTCGCCCCTTCG
GCGTGGAGCGCAATACCTCTATGCTTTTGAAGCGCATTCGCATTGGCAAAGACTCGTCGATAGGGATCAAGTCTG
TCATCGCCCCTGGTGCTGACATCCCGGAGAGGACCTGCATTGGTCCCAACTCGTCGAGCTGGGAACTTCGGGACG
CCGATGAGTCTAACCGCCAATTGCTGACCTCCCAGATCCCCAAGCCTCATTGGATCTGGATTCTCTTTATTGTTG
AGCCAATCAAGTTGATCACCTGGACAGCTGCTCGTATTACCTGGATGGCCGCTCTTCTTCCTATGGTTCTCGAGT
TCCCTACTCCTGCGGCAGACATGTTCCGGTCTACCCTAGAATGGTACACCAGTGATCAGCGGATTGCGTTCCACA
TCACCGCAAGGATCTGTCGTGCTGTTGGTGGCCCGATTGTGCTTTTTATTGCAGTCTTGATCATCAAGTTCTTCC
TCGATCTCATCTGTGGCAAGCCCAGACCTGGTCCTGCCTCAAAACAGACCACTCGCCAAAAGATTCGGAGTGCGG
TGCTTGCGCAGATTCTGCCCGCAGGTGACATCCACGGACTCACCCGCCTTACTGGTCGTCACTACGAATTTGTTT
CAATGGCTGTCCGTGCCCTTGGTGGCAAGGTTGGCAAGCATGTCTACTGGCCTAGTGTTGGTCCCGTCACTGTCG
ACTTTGATCTCATTGAGGTTGGTAACGATGTTGTTTTTGGTTCTCGCTCGACTCTGGTCACATCTGATGGCTACG
GCCGTGATCGCATCGTGATCGGTGATGGCACCATGGTTGGTGATCGTGTCGTCGCTTTGCCCGGTGCTACCATCG
GCCGTCAAGCAATGATAGGCTCCGGTGCTTTGCTTCGCCGGAATGGGGACTACCCTGCCAACAGTGTCTGGACTG
GTAGCAAGGGTGGTGAAGCTATACAGTTCCCAAGTTCCACCTCGACCTCCACTTCGACCGCTCCAACCATCATCG
GAGATGGTGGCAGCAGCCCCAACACTAGCGGCAGCGAAGACGAGAAAACACCGACCGAAAAGCAGACCTACTGTG
GAACTAAAGACAAGGCTGTTACCGAGATCGCTGAGCAGGAAGTGGATACATGCAAGCCTTTCGGTCGCGCCTTCT
ACCGCCACGAGGCCAACTACTACGTCCTCCGCATGTGGCAAATTGTCATCTATTCCACTTTTGCAGTTATTTTCA
CTACTGTGTATTGGCTTCTCACCGTCTTGTTCTCCCTTTTCGTTCTCCGCAGTGTCCTAAGCTACAGTGATGCTG
CTGGTTTCAAGCAAGGCGCCTGGCGCCCATTCGTTCTGTACGGCACGCTCGCCTCGATCCTATCTGTCATCACCA
CCGTTCAAGTCGCCCTTGCCTTCGGCATTATTCTCTGCATCAAATGGACGGTCGTGGGCCGTCGCAAGGAAGGCT
CCTACCACTGGGACAAGAGCAGCTACAACCAGCGCTGGCAATTCCTCCTTTCCTGCGAAACGTTGATCAAAGACT
GCTATGACGGAGTTGGTCTCCTGCCCATGATCTCTGGCTCTGCCTACATTTCCTGGTACTACCGCCTCTTGGGTG
CGAACATTGGAAAGGACTGTGCGATACACGCCAACGGTAGTCCCAGCATCTTTTTCACCGAGCCGGACCTCCTTA
CCCTTGGTGACCGTGTTGCTGTCGATGATGCCAGTTTGGTCTGCCACTTGAACTCCCGTGGTGGATTCGAGCTGC
ATACCTTGAACGTTGGGGATCGGAGTATCCTGCGCGCTGGATCGCGCTTGATGTCTGGTGCTTCGATGGGCCAGG
ATGCTTGTCTTTTAGAGCATACTCTGGTCCTGTCCGGAGACCATGTTGAGAATGGAGATACGCTCCAGGGATGGC
CGGCCGAAGGATTTGACGGGAAACGTGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail