Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g672.t1
Gene name
Locationscaffold_01:1731963..1735197
Strand-
Gene length (bp)3234
Transcript length (bp)3234
Coding sequence length (bp)3234
Protein length (aa) 1078

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08619 Nha1_C Alkali metal cation/H+ antiporter Nha1 C terminus 1.2E-106 460 999
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 4.6E-76 17 436

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006814 sodium ion transport Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0015385 sodium:proton antiporter activity Yes
GO:0006812 cation transport Yes
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0030001 metal ion transport No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0008324 cation transmembrane transporter activity No
GO:0051179 localization No
GO:0015291 secondary active transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0046873 metal ion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0015297 antiporter activity No
GO:0099516 ion antiporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0005451 monovalent cation:proton antiporter activity No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0015298 solute:cation antiporter activity No
GO:0008150 biological_process No
GO:0015491 cation:cation antiporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0015081 sodium ion transmembrane transporter activity No
GO:0006811 ion transport No
GO:0015672 monovalent inorganic cation transport No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015077 monovalent inorganic cation transmembrane transporter activity No
GO:0044425 membrane part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 13 32 19
2 102 124 22
3 201 223 22
4 244 263 19
5 293 315 22
6 328 345 17
7 360 382 22
8 412 434 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g672.t1
MAWDHLDIDKPHVAYMILGGFTALFMLCSLFVKEKLYIGEATVATLCGIIFGPHAADLFNPHKWGNVDKITLECS
RIVLVVQCFAVGVELPKAYMERHWKSVTLLLIPVMTWGWLMTSLFIWWMVPPLNWLESLVCAACVTATDPVLASS
VVGKGKFAKRVPKHLRDLLSAESGCNDGMAFPFIYLSFYIYHFRPQVGEVWLNWFCITVLYECILGAIFGFAIGY
FARHAIKLAERKGLIDRESFLVFYFVLAVFCAGSGSLLGMDDLLIGFACGVGFSNDGWFTEKTEESHVSNVIDLL
LNLAYFVYFGSIIPWEDYNSPELGLTPWRLVVIAILVLFFRRIPIMLMLKPIIPDVKTWREALFAGHFGPIGVGA
IFAAILARAELENDNTQPSPEDELPIPGTSNYYVVRLIWPITTFMVITSILVHGSSIAVFTLGKRINTLTITLSY
TQANEEGPSWMNRLPRVQSIAKGSMSFRKTDDTDASSDEKLPEYPPGTLPPIGMPGNFLRRQRDEEGDSESQNLE
SSRRKPLRRRRRKRAAGGGGPISQSAIMPASRRAEDEAEAEAEEKQELDQRDQAERGASPPRAERDRFGREPEIE
VYQEGHDMVIEDEEGNVLSTEDTSHMSPEEKTGHIEGQRKRLEKDKSGEFAASESQPHTKTEGDELEEKVGRSYG
NALKKWTKWTGLGKGRATEEEKAETEKKEKPKPRSAHAYQFGNTIIVEDEDGEVIKKYTLPGGKKGEKGEKTQKE
TTVPGEAPVRRGLNRMGTWLGMEEEGESSQAGHEKNKDNDWTADDGIRFTLAQDPQVDAQGIGHKGRRMNKQEFF
EQMKGLDAKARRDLVQQTDAPAPVQERAQHEAKEEAKAQGKQERHPAANTIPEEDTEAMDSESISDSDVSDDESS
NHHGSPNVAASLARFSRGVGTSAAQERRNNFSPAPPRIRDRPRRDSDDDGTERIPPSRLRQAAGLTAPPRQADDD
TGETPAERRRRLDALGVEGEESENGDGSDSDDNAIVEEDSDIEENETGQSSQNTKNNQPGETHKPSEQSSGSGSG
SGSGSNSQSTSRHIPRISWGGEKGREL*
Coding >Pro_DTO377G3_2|g672.t1
ATGGCGTGGGATCATCTGGACATCGATAAGCCGCATGTGGCTTACATGATCCTGGGAGGTTTCACAGCCCTGTTC
ATGCTGTGCTCCTTGTTCGTCAAGGAGAAGCTGTACATCGGTGAAGCCACCGTAGCCACGCTCTGTGGTATCATT
TTCGGCCCCCATGCGGCCGATTTGTTCAATCCGCATAAATGGGGAAACGTCGACAAAATCACTCTCGAGTGCTCG
CGAATTGTCCTGGTCGTGCAATGTTTCGCCGTCGGCGTTGAGTTGCCAAAGGCCTACATGGAACGCCATTGGAAG
TCGGTTACCTTGCTGCTGATCCCCGTCATGACGTGGGGTTGGTTAATGACCAGTCTGTTTATCTGGTGGATGGTG
CCTCCCCTGAACTGGCTGGAGTCTCTGGTGTGTGCTGCCTGTGTCACGGCTACCGATCCTGTCTTGGCGTCGTCA
GTCGTTGGTAAGGGAAAGTTCGCCAAGCGTGTCCCCAAGCATTTGCGTGACTTGTTATCTGCGGAGTCCGGGTGT
AACGATGGTATGGCTTTCCCATTCATCTACCTATCATTCTACATCTATCACTTCCGTCCTCAAGTCGGCGAGGTG
TGGCTAAACTGGTTCTGTATCACCGTTTTGTACGAGTGTATCTTGGGTGCTATTTTCGGCTTCGCCATCGGCTAT
TTTGCTCGCCATGCGATCAAGTTGGCTGAGCGCAAGGGATTGATCGATCGTGAGAGTTTCCTAGTATTCTACTTT
GTGTTGGCTGTATTCTGTGCTGGTTCTGGTTCTTTGCTGGGCATGGACGACCTGCTGATCGGATTCGCTTGTGGT
GTTGGATTCAGTAACGATGGTTGGTTTACGGAGAAGACAGAGGAATCTCATGTCTCCAACGTTATCGATCTTCTG
CTCAACTTGGCATACTTTGTCTATTTCGGATCCATCATTCCCTGGGAGGACTACAACTCCCCCGAGCTCGGCCTT
ACTCCTTGGCGGCTGGTGGTGATTGCGATATTGGTCCTCTTCTTCCGACGTATTCCCATTATGCTAATGCTCAAG
CCAATAATACCGGACGTCAAAACTTGGCGAGAAGCTTTATTCGCAGGGCATTTCGGTCCTATCGGTGTCGGTGCC
ATTTTCGCCGCCATCCTCGCTCGAGCGGAGCTGGAGAACGACAACACACAACCATCGCCTGAAGACGAGCTCCCA
ATACCAGGAACCAGCAATTACTATGTTGTCAGGCTTATCTGGCCCATCACTACATTCATGGTCATCACATCTATT
CTAGTACATGGTTCGTCTATTGCAGTTTTCACTCTGGGTAAACGTATCAACACCTTGACTATCACCCTATCCTAC
ACACAGGCCAACGAGGAGGGACCTTCATGGATGAACCGTCTTCCTCGTGTGCAGTCAATCGCCAAGGGCTCCATG
TCCTTCCGTAAGACGGATGATACGGATGCCTCATCGGACGAAAAGCTTCCTGAGTATCCTCCCGGTACCTTGCCC
CCCATCGGCATGCCTGGCAACTTCCTCCGCCGGCAACGTGACGAAGAGGGAGATAGTGAGTCACAAAACCTCGAG
TCTTCTCGTCGCAAGCCCCTGCGGAGACGTCGCCGTAAGCGTGCCGCTGGTGGCGGAGGCCCAATTAGCCAGTCT
GCTATTATGCCCGCTTCTCGGCGCGCCGAGGACGAAGCCGAGGCCGAGGCCGAAGAAAAGCAAGAACTTGATCAG
CGCGATCAGGCTGAGCGTGGAGCTTCTCCACCTCGTGCCGAGCGCGATCGATTCGGTCGTGAACCGGAGATAGAG
GTTTATCAAGAGGGCCACGACATGGTCATTGAGGATGAAGAGGGCAATGTTCTCTCGACTGAGGATACCTCTCAT
ATGTCTCCGGAAGAGAAGACTGGCCACATTGAAGGGCAACGCAAGCGTCTGGAAAAAGATAAATCAGGAGAATTT
GCAGCATCGGAGAGTCAACCCCACACAAAGACCGAGGGAGATGAGCTCGAGGAGAAGGTTGGTAGGTCATATGGA
AACGCTCTCAAGAAGTGGACCAAGTGGACCGGACTTGGAAAGGGTCGAGCCACGGAAGAGGAGAAGGCAGAGACC
GAAAAGAAAGAAAAGCCCAAACCTCGTTCAGCTCATGCATACCAATTCGGCAACACTATTATTGTTGAGGATGAG
GACGGTGAGGTGATCAAGAAATATACCCTTCCTGGCGGCAAGAAGGGTGAAAAGGGTGAGAAGACCCAGAAGGAG
ACCACCGTCCCTGGAGAGGCTCCTGTTCGACGTGGTTTGAACCGCATGGGGACCTGGCTCGGCATGGAAGAAGAA
GGCGAATCTTCCCAGGCTGGCCACGAAAAGAATAAAGATAACGATTGGACCGCCGACGACGGCATTCGATTCACG
TTGGCCCAGGATCCGCAAGTCGACGCTCAAGGCATTGGCCACAAGGGCCGACGTATGAACAAGCAGGAATTCTTC
GAGCAGATGAAGGGTCTTGACGCCAAGGCCCGCCGGGATCTGGTTCAGCAAACCGACGCACCAGCACCAGTTCAA
GAAAGGGCCCAGCACGAAGCCAAGGAAGAAGCCAAGGCCCAGGGAAAGCAAGAGCGCCACCCTGCCGCTAACACC
ATCCCCGAAGAAGACACTGAAGCTATGGATTCCGAGTCCATCAGCGATAGCGACGTTAGTGACGACGAGTCTAGC
AACCATCATGGTTCCCCTAACGTGGCCGCCTCACTGGCGAGGTTCTCGCGTGGCGTTGGTACCTCCGCCGCCCAA
GAACGCCGCAACAACTTCAGCCCTGCGCCACCCCGTATACGGGACCGGCCTCGCCGAGATTCCGACGACGATGGT
ACAGAGCGTATCCCACCTTCGCGTCTCCGTCAAGCCGCTGGTCTCACTGCGCCCCCACGCCAGGCTGACGACGAC
ACAGGCGAGACCCCAGCCGAGCGTCGTCGCCGTCTGGACGCCTTAGGTGTGGAAGGTGAGGAGTCCGAGAATGGC
GATGGCTCAGATTCGGATGATAATGCCATCGTGGAGGAAGACTCAGACATTGAAGAGAACGAGACTGGCCAATCA
AGCCAGAATACGAAAAACAACCAGCCCGGCGAAACACACAAGCCATCTGAACAGTCCTCTGGATCTGGATCTGGA
TCTGGATCCGGCTCCAACTCCCAATCTACCTCCCGACACATCCCGCGTATTTCATGGGGAGGCGAGAAGGGACGC
GAGCTTTAA
Transcript >Pro_DTO377G3_2|g672.t1
ATGGCGTGGGATCATCTGGACATCGATAAGCCGCATGTGGCTTACATGATCCTGGGAGGTTTCACAGCCCTGTTC
ATGCTGTGCTCCTTGTTCGTCAAGGAGAAGCTGTACATCGGTGAAGCCACCGTAGCCACGCTCTGTGGTATCATT
TTCGGCCCCCATGCGGCCGATTTGTTCAATCCGCATAAATGGGGAAACGTCGACAAAATCACTCTCGAGTGCTCG
CGAATTGTCCTGGTCGTGCAATGTTTCGCCGTCGGCGTTGAGTTGCCAAAGGCCTACATGGAACGCCATTGGAAG
TCGGTTACCTTGCTGCTGATCCCCGTCATGACGTGGGGTTGGTTAATGACCAGTCTGTTTATCTGGTGGATGGTG
CCTCCCCTGAACTGGCTGGAGTCTCTGGTGTGTGCTGCCTGTGTCACGGCTACCGATCCTGTCTTGGCGTCGTCA
GTCGTTGGTAAGGGAAAGTTCGCCAAGCGTGTCCCCAAGCATTTGCGTGACTTGTTATCTGCGGAGTCCGGGTGT
AACGATGGTATGGCTTTCCCATTCATCTACCTATCATTCTACATCTATCACTTCCGTCCTCAAGTCGGCGAGGTG
TGGCTAAACTGGTTCTGTATCACCGTTTTGTACGAGTGTATCTTGGGTGCTATTTTCGGCTTCGCCATCGGCTAT
TTTGCTCGCCATGCGATCAAGTTGGCTGAGCGCAAGGGATTGATCGATCGTGAGAGTTTCCTAGTATTCTACTTT
GTGTTGGCTGTATTCTGTGCTGGTTCTGGTTCTTTGCTGGGCATGGACGACCTGCTGATCGGATTCGCTTGTGGT
GTTGGATTCAGTAACGATGGTTGGTTTACGGAGAAGACAGAGGAATCTCATGTCTCCAACGTTATCGATCTTCTG
CTCAACTTGGCATACTTTGTCTATTTCGGATCCATCATTCCCTGGGAGGACTACAACTCCCCCGAGCTCGGCCTT
ACTCCTTGGCGGCTGGTGGTGATTGCGATATTGGTCCTCTTCTTCCGACGTATTCCCATTATGCTAATGCTCAAG
CCAATAATACCGGACGTCAAAACTTGGCGAGAAGCTTTATTCGCAGGGCATTTCGGTCCTATCGGTGTCGGTGCC
ATTTTCGCCGCCATCCTCGCTCGAGCGGAGCTGGAGAACGACAACACACAACCATCGCCTGAAGACGAGCTCCCA
ATACCAGGAACCAGCAATTACTATGTTGTCAGGCTTATCTGGCCCATCACTACATTCATGGTCATCACATCTATT
CTAGTACATGGTTCGTCTATTGCAGTTTTCACTCTGGGTAAACGTATCAACACCTTGACTATCACCCTATCCTAC
ACACAGGCCAACGAGGAGGGACCTTCATGGATGAACCGTCTTCCTCGTGTGCAGTCAATCGCCAAGGGCTCCATG
TCCTTCCGTAAGACGGATGATACGGATGCCTCATCGGACGAAAAGCTTCCTGAGTATCCTCCCGGTACCTTGCCC
CCCATCGGCATGCCTGGCAACTTCCTCCGCCGGCAACGTGACGAAGAGGGAGATAGTGAGTCACAAAACCTCGAG
TCTTCTCGTCGCAAGCCCCTGCGGAGACGTCGCCGTAAGCGTGCCGCTGGTGGCGGAGGCCCAATTAGCCAGTCT
GCTATTATGCCCGCTTCTCGGCGCGCCGAGGACGAAGCCGAGGCCGAGGCCGAAGAAAAGCAAGAACTTGATCAG
CGCGATCAGGCTGAGCGTGGAGCTTCTCCACCTCGTGCCGAGCGCGATCGATTCGGTCGTGAACCGGAGATAGAG
GTTTATCAAGAGGGCCACGACATGGTCATTGAGGATGAAGAGGGCAATGTTCTCTCGACTGAGGATACCTCTCAT
ATGTCTCCGGAAGAGAAGACTGGCCACATTGAAGGGCAACGCAAGCGTCTGGAAAAAGATAAATCAGGAGAATTT
GCAGCATCGGAGAGTCAACCCCACACAAAGACCGAGGGAGATGAGCTCGAGGAGAAGGTTGGTAGGTCATATGGA
AACGCTCTCAAGAAGTGGACCAAGTGGACCGGACTTGGAAAGGGTCGAGCCACGGAAGAGGAGAAGGCAGAGACC
GAAAAGAAAGAAAAGCCCAAACCTCGTTCAGCTCATGCATACCAATTCGGCAACACTATTATTGTTGAGGATGAG
GACGGTGAGGTGATCAAGAAATATACCCTTCCTGGCGGCAAGAAGGGTGAAAAGGGTGAGAAGACCCAGAAGGAG
ACCACCGTCCCTGGAGAGGCTCCTGTTCGACGTGGTTTGAACCGCATGGGGACCTGGCTCGGCATGGAAGAAGAA
GGCGAATCTTCCCAGGCTGGCCACGAAAAGAATAAAGATAACGATTGGACCGCCGACGACGGCATTCGATTCACG
TTGGCCCAGGATCCGCAAGTCGACGCTCAAGGCATTGGCCACAAGGGCCGACGTATGAACAAGCAGGAATTCTTC
GAGCAGATGAAGGGTCTTGACGCCAAGGCCCGCCGGGATCTGGTTCAGCAAACCGACGCACCAGCACCAGTTCAA
GAAAGGGCCCAGCACGAAGCCAAGGAAGAAGCCAAGGCCCAGGGAAAGCAAGAGCGCCACCCTGCCGCTAACACC
ATCCCCGAAGAAGACACTGAAGCTATGGATTCCGAGTCCATCAGCGATAGCGACGTTAGTGACGACGAGTCTAGC
AACCATCATGGTTCCCCTAACGTGGCCGCCTCACTGGCGAGGTTCTCGCGTGGCGTTGGTACCTCCGCCGCCCAA
GAACGCCGCAACAACTTCAGCCCTGCGCCACCCCGTATACGGGACCGGCCTCGCCGAGATTCCGACGACGATGGT
ACAGAGCGTATCCCACCTTCGCGTCTCCGTCAAGCCGCTGGTCTCACTGCGCCCCCACGCCAGGCTGACGACGAC
ACAGGCGAGACCCCAGCCGAGCGTCGTCGCCGTCTGGACGCCTTAGGTGTGGAAGGTGAGGAGTCCGAGAATGGC
GATGGCTCAGATTCGGATGATAATGCCATCGTGGAGGAAGACTCAGACATTGAAGAGAACGAGACTGGCCAATCA
AGCCAGAATACGAAAAACAACCAGCCCGGCGAAACACACAAGCCATCTGAACAGTCCTCTGGATCTGGATCTGGA
TCTGGATCCGGCTCCAACTCCCAATCTACCTCCCGACACATCCCGCGTATTTCATGGGGAGGCGAGAAGGGACGC
GAGCTTTAA
Gene >Pro_DTO377G3_2|g672.t1
ATGGCGTGGGATCATCTGGACATCGATAAGCCGCATGTGGCTTACATGATCCTGGGAGGTTTCACAGCCCTGTTC
ATGCTGTGCTCCTTGTTCGTCAAGGAGAAGCTGTACATCGGTGAAGCCACCGTAGCCACGCTCTGTGGTATCATT
TTCGGCCCCCATGCGGCCGATTTGTTCAATCCGCATAAATGGGGAAACGTCGACAAAATCACTCTCGAGTGCTCG
CGAATTGTCCTGGTCGTGCAATGTTTCGCCGTCGGCGTTGAGTTGCCAAAGGCCTACATGGAACGCCATTGGAAG
TCGGTTACCTTGCTGCTGATCCCCGTCATGACGTGGGGTTGGTTAATGACCAGTCTGTTTATCTGGTGGATGGTG
CCTCCCCTGAACTGGCTGGAGTCTCTGGTGTGTGCTGCCTGTGTCACGGCTACCGATCCTGTCTTGGCGTCGTCA
GTCGTTGGTAAGGGAAAGTTCGCCAAGCGTGTCCCCAAGCATTTGCGTGACTTGTTATCTGCGGAGTCCGGGTGT
AACGATGGTATGGCTTTCCCATTCATCTACCTATCATTCTACATCTATCACTTCCGTCCTCAAGTCGGCGAGGTG
TGGCTAAACTGGTTCTGTATCACCGTTTTGTACGAGTGTATCTTGGGTGCTATTTTCGGCTTCGCCATCGGCTAT
TTTGCTCGCCATGCGATCAAGTTGGCTGAGCGCAAGGGATTGATCGATCGTGAGAGTTTCCTAGTATTCTACTTT
GTGTTGGCTGTATTCTGTGCTGGTTCTGGTTCTTTGCTGGGCATGGACGACCTGCTGATCGGATTCGCTTGTGGT
GTTGGATTCAGTAACGATGGTTGGTTTACGGAGAAGACAGAGGAATCTCATGTCTCCAACGTTATCGATCTTCTG
CTCAACTTGGCATACTTTGTCTATTTCGGATCCATCATTCCCTGGGAGGACTACAACTCCCCCGAGCTCGGCCTT
ACTCCTTGGCGGCTGGTGGTGATTGCGATATTGGTCCTCTTCTTCCGACGTATTCCCATTATGCTAATGCTCAAG
CCAATAATACCGGACGTCAAAACTTGGCGAGAAGCTTTATTCGCAGGGCATTTCGGTCCTATCGGTGTCGGTGCC
ATTTTCGCCGCCATCCTCGCTCGAGCGGAGCTGGAGAACGACAACACACAACCATCGCCTGAAGACGAGCTCCCA
ATACCAGGAACCAGCAATTACTATGTTGTCAGGCTTATCTGGCCCATCACTACATTCATGGTCATCACATCTATT
CTAGTACATGGTTCGTCTATTGCAGTTTTCACTCTGGGTAAACGTATCAACACCTTGACTATCACCCTATCCTAC
ACACAGGCCAACGAGGAGGGACCTTCATGGATGAACCGTCTTCCTCGTGTGCAGTCAATCGCCAAGGGCTCCATG
TCCTTCCGTAAGACGGATGATACGGATGCCTCATCGGACGAAAAGCTTCCTGAGTATCCTCCCGGTACCTTGCCC
CCCATCGGCATGCCTGGCAACTTCCTCCGCCGGCAACGTGACGAAGAGGGAGATAGTGAGTCACAAAACCTCGAG
TCTTCTCGTCGCAAGCCCCTGCGGAGACGTCGCCGTAAGCGTGCCGCTGGTGGCGGAGGCCCAATTAGCCAGTCT
GCTATTATGCCCGCTTCTCGGCGCGCCGAGGACGAAGCCGAGGCCGAGGCCGAAGAAAAGCAAGAACTTGATCAG
CGCGATCAGGCTGAGCGTGGAGCTTCTCCACCTCGTGCCGAGCGCGATCGATTCGGTCGTGAACCGGAGATAGAG
GTTTATCAAGAGGGCCACGACATGGTCATTGAGGATGAAGAGGGCAATGTTCTCTCGACTGAGGATACCTCTCAT
ATGTCTCCGGAAGAGAAGACTGGCCACATTGAAGGGCAACGCAAGCGTCTGGAAAAAGATAAATCAGGAGAATTT
GCAGCATCGGAGAGTCAACCCCACACAAAGACCGAGGGAGATGAGCTCGAGGAGAAGGTTGGTAGGTCATATGGA
AACGCTCTCAAGAAGTGGACCAAGTGGACCGGACTTGGAAAGGGTCGAGCCACGGAAGAGGAGAAGGCAGAGACC
GAAAAGAAAGAAAAGCCCAAACCTCGTTCAGCTCATGCATACCAATTCGGCAACACTATTATTGTTGAGGATGAG
GACGGTGAGGTGATCAAGAAATATACCCTTCCTGGCGGCAAGAAGGGTGAAAAGGGTGAGAAGACCCAGAAGGAG
ACCACCGTCCCTGGAGAGGCTCCTGTTCGACGTGGTTTGAACCGCATGGGGACCTGGCTCGGCATGGAAGAAGAA
GGCGAATCTTCCCAGGCTGGCCACGAAAAGAATAAAGATAACGATTGGACCGCCGACGACGGCATTCGATTCACG
TTGGCCCAGGATCCGCAAGTCGACGCTCAAGGCATTGGCCACAAGGGCCGACGTATGAACAAGCAGGAATTCTTC
GAGCAGATGAAGGGTCTTGACGCCAAGGCCCGCCGGGATCTGGTTCAGCAAACCGACGCACCAGCACCAGTTCAA
GAAAGGGCCCAGCACGAAGCCAAGGAAGAAGCCAAGGCCCAGGGAAAGCAAGAGCGCCACCCTGCCGCTAACACC
ATCCCCGAAGAAGACACTGAAGCTATGGATTCCGAGTCCATCAGCGATAGCGACGTTAGTGACGACGAGTCTAGC
AACCATCATGGTTCCCCTAACGTGGCCGCCTCACTGGCGAGGTTCTCGCGTGGCGTTGGTACCTCCGCCGCCCAA
GAACGCCGCAACAACTTCAGCCCTGCGCCACCCCGTATACGGGACCGGCCTCGCCGAGATTCCGACGACGATGGT
ACAGAGCGTATCCCACCTTCGCGTCTCCGTCAAGCCGCTGGTCTCACTGCGCCCCCACGCCAGGCTGACGACGAC
ACAGGCGAGACCCCAGCCGAGCGTCGTCGCCGTCTGGACGCCTTAGGTGTGGAAGGTGAGGAGTCCGAGAATGGC
GATGGCTCAGATTCGGATGATAATGCCATCGTGGAGGAAGACTCAGACATTGAAGAGAACGAGACTGGCCAATCA
AGCCAGAATACGAAAAACAACCAGCCCGGCGAAACACACAAGCCATCTGAACAGTCCTCTGGATCTGGATCTGGA
TCTGGATCCGGCTCCAACTCCCAATCTACCTCCCGACACATCCCGCGTATTTCATGGGGAGGCGAGAAGGGACGC
GAGCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail