Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6709.t1
Gene name
Locationscaffold_18:294793..300022
Strand+
Gene length (bp)5229
Transcript length (bp)4470
Coding sequence length (bp)4470
Protein length (aa) 1490

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 1.5E-46 487 696
PF01061 ABC2_membrane ABC-2 type transporter 4.9E-36 1162 1371
PF00005 ABC_tran ABC transporter 2.4E-16 168 329
PF00005 ABC_tran ABC transporter 1.4E-17 863 1014
PF06422 PDR_CDR CDR ABC transporter 4.4E-25 709 795
PF14510 ABC_trans_N ABC-transporter N-terminal 9.2E-11 47 137

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016021 integral component of membrane Yes
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0016887 ATPase activity Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0016462 pyrophosphatase activity No
GO:0017111 nucleoside-triphosphatase activity No
GO:0022804 active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0051234 establishment of localization No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0044425 membrane part No
GO:0005488 binding No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043167 ion binding No
GO:0042623 ATPase activity, coupled No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0008144 drug binding No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0030554 adenyl nucleotide binding No
GO:0022857 transmembrane transporter activity No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 505 527 22
2 539 561 22
3 581 603 22
4 616 638 22
5 648 667 19
6 751 773 22
7 1185 1207 22
8 1253 1275 22
9 1304 1326 22
10 1333 1355 22
11 1445 1467 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6709.t1
MANDHSMESESASSTNPEHIPENSVSSSEGSSSRASSSPSEAYTPTRTASSDTQADSTAPKKTDDGLARTKSRHK
ASGHDPQGEEWAQIERLISRMFGPERKANSEEEKTRHVGVLWKNLTVKGVGLGAALQPTNGDIFLGLPRLIKQLL
TRGRKGAGAKKAAIRTILDDFNGCVRPGEMLLVLGRPGSGCSTFLKMLGNQRAGYESIEGDVRYGGTDSEKMAKE
YRSEVLYNPEDDLHYATLTVRDTLLFALKARTPDKASRIPGESRKEYQQTFLTAIAKLFWIEHALGTKVGNELIR
GVSGGEKKRTSIAEAMVTKASTQCWDNSTKGLDASTALEYVQSLRSLTNTANVSTIVALYQASENLFDLFDKVIL
IEEGKCSFFGPTQDAKAYFEGLGFECPPRWTTPDFLTSVNDPYARRVKDGWDDRIPRNAAEFQAAYRKSDTYQSN
LADMKSFEGDIESQRQEREAARSEAKRKNFTISFYKQVMILTHRQFLVMIGDRDSLIGKWSMITFQALIIGSLFY
NLPDTSSGVFTRGGVMFLILLFNSLLAMAELTAAFGSRPILMKHKSFSFYRPAAYALAQVVVDVPLVFIQVVLFD
IIVYFMANLARTPSQFFINLLFIFILTMTMYSFFRALGALCASLDVATRLTGVAIQALVVYTGYLIPPWKMHPWL
KWLIWINPVQYAFEALMANEFHNLQIKCETPYIVPDGPNAVPGHQSCAIQGSDIDQLIVHGPKYIQTAYTYSRAH
LWRNFGIITGWLIFFVCLTMLGMELQRPNKGGSSVTVFKRSEAPQAVQDVIKQSGPRKDEESTEADGAASNENNG
DTSVPHEKVRDIATNTAIFTWQDVDYTIPYKGGQRQLLQNVKGYVKPGRLTALMGASGSGKTTLLNALAQRINFG
VVTGNFLVDGRPLPRSFQRATGFAEQMDIHEPTATVRESLRFSALLRQPKEVPLKEKYDYCETIIDLLEMRSIAG
AIVGSMGSGLNQEQRKRLTIAVELASKPELLLFLDEPTSGLDSLAAFNIVRFLRRLADAGQAILCTIHQPSAVLF
ENFDELLLLKSGGIVVYNGPLGNDSKTLIDYFEQNGGRNCSPHENPAEYMLEVIGAGNPDYKGQDWGNVWANSPE
SKQLSGDLEGIIASRRNAQNDQKVDDDREYAMPLYVQTVAVTKRAFVAYWRIPDYILGKFMLHIFTGLFNTFTFW
HLGNSFIDMQSRLFSVFMTLTIAPPLIQQLQPRYIHFRGLYESREANSKIYSWAAFVTSTIIPELPYSVVAGSIY
FNCWYWGTWFPRDSFTSGYVWMSMMLFELYYIGLGQFIAAIAPNVLFASLLVPTFFTFVASFCGVVVPYVAIPHF
WQAWMYWLTPFHYLLEGFVGAITHNVPVRCIEREESRFSTPPGMNCQEYAGSYAEKSGGYVRDIGNGMCSFCQYS
VGDNFASSLNVFYSHKWRDYGIIWGFIIFNFAVVFIFSWLYLHGISDVKRWLSARKTRKSKARP*
Coding >Pro_DTO377G3_2|g6709.t1
ATGGCAAACGACCATTCTATGGAAAGCGAGTCCGCATCATCTACAAACCCAGAACACATTCCTGAAAATTCCGTT
TCTTCCTCTGAGGGTTCATCTTCGCGAGCCAGTTCGTCTCCATCCGAAGCTTACACGCCAACCCGCACTGCCTCA
TCAGACACCCAGGCAGATTCCACGGCGCCAAAGAAAACTGACGATGGCCTCGCACGTACTAAATCTCGACACAAA
GCCTCCGGTCATGATCCTCAGGGAGAGGAATGGGCCCAGATAGAAAGACTGATCTCACGGATGTTCGGCCCTGAG
CGCAAAGCAAATTCCGAAGAAGAGAAAACACGTCATGTTGGAGTTCTATGGAAGAACCTCACTGTAAAAGGTGTC
GGCCTCGGAGCTGCTCTACAACCCACCAACGGGGATATTTTTCTCGGCTTACCACGGCTCATCAAGCAACTACTC
ACTCGGGGCAGAAAAGGTGCCGGGGCCAAAAAAGCAGCGATACGAACTATCTTAGATGATTTCAATGGTTGTGTT
CGTCCGGGGGAGATGCTTCTTGTTCTGGGCCGCCCTGGCTCTGGCTGTTCCACTTTCTTGAAAATGCTTGGCAAT
CAACGAGCGGGCTACGAAAGCATTGAAGGCGATGTGCGGTATGGCGGCACAGACTCTGAAAAAATGGCAAAGGAG
TATAGGTCAGAAGTCTTGTACAACCCTGAGGATGATCTCCATTATGCAACTTTGACTGTGCGAGATACACTGCTT
TTTGCCTTGAAAGCTCGAACCCCCGACAAAGCCTCAAGAATACCAGGAGAAAGCCGAAAGGAATACCAGCAGACA
TTCTTGACCGCCATAGCTAAGTTGTTCTGGATTGAACATGCTCTGGGAACCAAAGTTGGGAACGAACTCATTCGT
GGAGTTTCTGGGGGTGAGAAGAAACGAACCTCAATTGCGGAAGCTATGGTTACAAAGGCTAGTACCCAGTGCTGG
GACAACTCTACCAAGGGTTTGGACGCCAGTACAGCGCTAGAGTATGTTCAAAGCTTGCGAAGTCTAACAAATACC
GCCAACGTTTCAACGATAGTAGCTCTCTACCAGGCATCGGAGAATTTATTTGACCTTTTTGACAAGGTGATCTTA
ATCGAAGAGGGAAAATGCTCTTTCTTCGGCCCTACCCAGGACGCAAAGGCCTATTTCGAAGGACTGGGCTTTGAA
TGCCCCCCGCGTTGGACAACTCCCGACTTTTTGACTTCTGTCAATGACCCCTATGCGCGGCGTGTCAAAGATGGC
TGGGACGACCGAATTCCTCGGAATGCAGCTGAATTTCAAGCTGCATATCGCAAAAGTGATACTTACCAAAGCAAC
CTAGCGGATATGAAAAGCTTTGAGGGCGATATCGAAAGCCAAAGGCAGGAGAGAGAGGCTGCAAGAAGTGAGGCC
AAACGAAAAAACTTCACCATCTCATTCTACAAACAAGTTATGATTCTCACACATCGTCAATTTCTGGTAATGATT
GGTGATAGAGATTCGTTGATTGGAAAGTGGAGTATGATAACCTTTCAAGCTCTCATTATTGGTAGTCTATTTTAC
AACCTTCCCGATACAAGTTCTGGCGTTTTTACTAGGGGTGGTGTGATGTTCCTTATACTGCTTTTCAATTCATTG
CTTGCTATGGCAGAGCTGACAGCAGCATTTGGGAGCCGACCAATTTTGATGAAACACAAAAGCTTCTCTTTCTAC
CGGCCAGCAGCATATGCGCTTGCCCAGGTTGTGGTTGATGTGCCTCTCGTGTTCATACAAGTCGTTCTATTTGAT
ATCATAGTATACTTCATGGCAAATCTTGCTCGAACACCCTCACAGTTCTTTATAAATCTGCTTTTCATTTTCATT
CTCACAATGACTATGTACTCCTTCTTTCGTGCCCTGGGGGCTCTATGTGCCTCATTGGATGTTGCCACCCGCCTC
ACTGGTGTCGCCATACAGGCATTGGTTGTGTACACAGGCTATCTCATCCCACCGTGGAAAATGCACCCATGGTTA
AAGTGGCTCATTTGGATCAACCCTGTCCAATACGCATTCGAGGCATTGATGGCCAACGAGTTCCACAATCTCCAG
ATCAAATGTGAAACGCCCTACATTGTGCCTGATGGGCCAAATGCTGTGCCTGGTCACCAGTCATGTGCAATACAA
GGCAGTGATATAGACCAGTTGATCGTTCATGGTCCCAAGTATATCCAAACGGCGTACACTTACTCCAGGGCTCAC
CTGTGGCGGAATTTCGGCATCATTACAGGATGGCTTATCTTTTTCGTCTGCTTGACAATGTTGGGAATGGAATTA
CAGAGACCTAATAAGGGCGGCAGCTCGGTCACGGTGTTCAAAAGAAGTGAAGCCCCCCAAGCAGTTCAAGATGTC
ATCAAGCAATCCGGCCCCCGAAAAGATGAGGAATCCACAGAGGCGGATGGCGCAGCATCCAACGAAAACAACGGC
GACACGAGTGTACCTCATGAAAAAGTCCGGGATATTGCTACAAACACGGCAATCTTTACATGGCAAGACGTTGAC
TACACCATTCCATACAAGGGTGGACAGAGACAACTTTTGCAAAATGTTAAAGGGTATGTCAAGCCTGGTCGGCTG
ACTGCATTGATGGGTGCTTCTGGCTCGGGCAAAACCACCTTGCTCAATGCGCTAGCACAGCGCATCAATTTTGGC
GTGGTCACCGGCAACTTCTTAGTTGATGGGAGGCCTCTCCCAAGGAGCTTTCAGAGAGCCACGGGATTCGCCGAG
CAGATGGACATTCACGAACCCACTGCTACTGTGCGGGAGTCTCTTCGGTTCTCCGCTCTGTTGCGGCAGCCGAAA
GAAGTCCCATTAAAAGAAAAGTATGATTATTGTGAGACAATCATTGACTTATTAGAAATGCGTTCCATCGCCGGG
GCAATTGTTGGATCCATGGGCTCAGGCCTCAACCAAGAGCAGCGCAAACGACTCACAATTGCAGTTGAACTAGCA
AGTAAACCAGAGCTTTTGCTATTCCTAGATGAACCCACGTCAGGCCTCGATTCTCTGGCCGCGTTCAACATTGTA
CGCTTCCTTCGCCGACTCGCAGATGCCGGTCAGGCCATTCTCTGCACAATACATCAACCTTCTGCTGTCTTATTC
GAGAACTTCGATGAGCTCTTGCTACTGAAAAGCGGTGGAATTGTTGTTTATAATGGGCCCCTTGGAAACGACTCC
AAGACGCTGATTGATTACTTTGAACAAAACGGCGGGAGGAATTGCTCACCACATGAAAATCCGGCAGAGTATATG
TTGGAAGTCATTGGAGCCGGAAATCCCGATTATAAGGGACAGGACTGGGGTAATGTATGGGCCAACTCGCCAGAA
TCCAAACAGCTTTCTGGGGACCTTGAAGGTATAATCGCCTCTCGTCGCAACGCTCAAAATGACCAGAAGGTTGAC
GACGATCGCGAATACGCGATGCCTCTCTATGTTCAAACAGTCGCAGTCACTAAGCGCGCATTCGTGGCTTACTGG
AGGATCCCAGACTACATCCTTGGTAAATTCATGCTCCACATCTTTACCGGCCTTTTCAACACCTTCACATTCTGG
CATTTGGGAAATAGCTTTATCGACATGCAATCACGACTTTTCTCTGTTTTCATGACCTTGACGATAGCCCCACCG
CTGATACAGCAACTCCAACCACGATATATTCATTTTCGAGGCCTTTATGAATCTCGAGAGGCTAACTCAAAGATC
TACTCTTGGGCTGCCTTTGTGACGAGCACAATCATCCCAGAACTGCCATACTCGGTTGTTGCCGGGTCCATTTAC
TTCAACTGCTGGTACTGGGGAACTTGGTTCCCGCGCGACTCGTTTACCTCCGGCTACGTTTGGATGTCGATGATG
CTTTTTGAACTATATTATATCGGCCTTGGTCAATTCATAGCTGCAATTGCACCAAATGTGCTATTTGCAAGTTTG
CTCGTGCCAACTTTCTTTACCTTTGTTGCTTCCTTCTGCGGCGTTGTCGTCCCTTATGTCGCAATACCGCATTTT
TGGCAAGCGTGGATGTACTGGCTTACGCCTTTCCACTATCTGCTTGAGGGATTTGTTGGAGCCATCACCCATAAT
GTCCCCGTGCGGTGTATTGAGCGCGAAGAATCCCGCTTTAGCACTCCACCTGGCATGAACTGCCAAGAATATGCT
GGGTCTTATGCCGAAAAATCCGGTGGATATGTCCGAGACATTGGGAATGGAATGTGCTCATTCTGTCAATACTCA
GTCGGTGATAATTTTGCTAGTAGCCTCAATGTTTTTTACTCGCACAAATGGAGAGATTATGGGATCATCTGGGGA
TTCATTATCTTCAACTTTGCTGTTGTTTTCATCTTCTCCTGGTTGTATTTGCACGGTATCAGCGACGTGAAACGC
TGGCTCAGTGCGCGTAAGACGAGAAAGAGCAAAGCTCGTCCTTGA
Transcript >Pro_DTO377G3_2|g6709.t1
ATGGCAAACGACCATTCTATGGAAAGCGAGTCCGCATCATCTACAAACCCAGAACACATTCCTGAAAATTCCGTT
TCTTCCTCTGAGGGTTCATCTTCGCGAGCCAGTTCGTCTCCATCCGAAGCTTACACGCCAACCCGCACTGCCTCA
TCAGACACCCAGGCAGATTCCACGGCGCCAAAGAAAACTGACGATGGCCTCGCACGTACTAAATCTCGACACAAA
GCCTCCGGTCATGATCCTCAGGGAGAGGAATGGGCCCAGATAGAAAGACTGATCTCACGGATGTTCGGCCCTGAG
CGCAAAGCAAATTCCGAAGAAGAGAAAACACGTCATGTTGGAGTTCTATGGAAGAACCTCACTGTAAAAGGTGTC
GGCCTCGGAGCTGCTCTACAACCCACCAACGGGGATATTTTTCTCGGCTTACCACGGCTCATCAAGCAACTACTC
ACTCGGGGCAGAAAAGGTGCCGGGGCCAAAAAAGCAGCGATACGAACTATCTTAGATGATTTCAATGGTTGTGTT
CGTCCGGGGGAGATGCTTCTTGTTCTGGGCCGCCCTGGCTCTGGCTGTTCCACTTTCTTGAAAATGCTTGGCAAT
CAACGAGCGGGCTACGAAAGCATTGAAGGCGATGTGCGGTATGGCGGCACAGACTCTGAAAAAATGGCAAAGGAG
TATAGGTCAGAAGTCTTGTACAACCCTGAGGATGATCTCCATTATGCAACTTTGACTGTGCGAGATACACTGCTT
TTTGCCTTGAAAGCTCGAACCCCCGACAAAGCCTCAAGAATACCAGGAGAAAGCCGAAAGGAATACCAGCAGACA
TTCTTGACCGCCATAGCTAAGTTGTTCTGGATTGAACATGCTCTGGGAACCAAAGTTGGGAACGAACTCATTCGT
GGAGTTTCTGGGGGTGAGAAGAAACGAACCTCAATTGCGGAAGCTATGGTTACAAAGGCTAGTACCCAGTGCTGG
GACAACTCTACCAAGGGTTTGGACGCCAGTACAGCGCTAGAGTATGTTCAAAGCTTGCGAAGTCTAACAAATACC
GCCAACGTTTCAACGATAGTAGCTCTCTACCAGGCATCGGAGAATTTATTTGACCTTTTTGACAAGGTGATCTTA
ATCGAAGAGGGAAAATGCTCTTTCTTCGGCCCTACCCAGGACGCAAAGGCCTATTTCGAAGGACTGGGCTTTGAA
TGCCCCCCGCGTTGGACAACTCCCGACTTTTTGACTTCTGTCAATGACCCCTATGCGCGGCGTGTCAAAGATGGC
TGGGACGACCGAATTCCTCGGAATGCAGCTGAATTTCAAGCTGCATATCGCAAAAGTGATACTTACCAAAGCAAC
CTAGCGGATATGAAAAGCTTTGAGGGCGATATCGAAAGCCAAAGGCAGGAGAGAGAGGCTGCAAGAAGTGAGGCC
AAACGAAAAAACTTCACCATCTCATTCTACAAACAAGTTATGATTCTCACACATCGTCAATTTCTGGTAATGATT
GGTGATAGAGATTCGTTGATTGGAAAGTGGAGTATGATAACCTTTCAAGCTCTCATTATTGGTAGTCTATTTTAC
AACCTTCCCGATACAAGTTCTGGCGTTTTTACTAGGGGTGGTGTGATGTTCCTTATACTGCTTTTCAATTCATTG
CTTGCTATGGCAGAGCTGACAGCAGCATTTGGGAGCCGACCAATTTTGATGAAACACAAAAGCTTCTCTTTCTAC
CGGCCAGCAGCATATGCGCTTGCCCAGGTTGTGGTTGATGTGCCTCTCGTGTTCATACAAGTCGTTCTATTTGAT
ATCATAGTATACTTCATGGCAAATCTTGCTCGAACACCCTCACAGTTCTTTATAAATCTGCTTTTCATTTTCATT
CTCACAATGACTATGTACTCCTTCTTTCGTGCCCTGGGGGCTCTATGTGCCTCATTGGATGTTGCCACCCGCCTC
ACTGGTGTCGCCATACAGGCATTGGTTGTGTACACAGGCTATCTCATCCCACCGTGGAAAATGCACCCATGGTTA
AAGTGGCTCATTTGGATCAACCCTGTCCAATACGCATTCGAGGCATTGATGGCCAACGAGTTCCACAATCTCCAG
ATCAAATGTGAAACGCCCTACATTGTGCCTGATGGGCCAAATGCTGTGCCTGGTCACCAGTCATGTGCAATACAA
GGCAGTGATATAGACCAGTTGATCGTTCATGGTCCCAAGTATATCCAAACGGCGTACACTTACTCCAGGGCTCAC
CTGTGGCGGAATTTCGGCATCATTACAGGATGGCTTATCTTTTTCGTCTGCTTGACAATGTTGGGAATGGAATTA
CAGAGACCTAATAAGGGCGGCAGCTCGGTCACGGTGTTCAAAAGAAGTGAAGCCCCCCAAGCAGTTCAAGATGTC
ATCAAGCAATCCGGCCCCCGAAAAGATGAGGAATCCACAGAGGCGGATGGCGCAGCATCCAACGAAAACAACGGC
GACACGAGTGTACCTCATGAAAAAGTCCGGGATATTGCTACAAACACGGCAATCTTTACATGGCAAGACGTTGAC
TACACCATTCCATACAAGGGTGGACAGAGACAACTTTTGCAAAATGTTAAAGGGTATGTCAAGCCTGGTCGGCTG
ACTGCATTGATGGGTGCTTCTGGCTCGGGCAAAACCACCTTGCTCAATGCGCTAGCACAGCGCATCAATTTTGGC
GTGGTCACCGGCAACTTCTTAGTTGATGGGAGGCCTCTCCCAAGGAGCTTTCAGAGAGCCACGGGATTCGCCGAG
CAGATGGACATTCACGAACCCACTGCTACTGTGCGGGAGTCTCTTCGGTTCTCCGCTCTGTTGCGGCAGCCGAAA
GAAGTCCCATTAAAAGAAAAGTATGATTATTGTGAGACAATCATTGACTTATTAGAAATGCGTTCCATCGCCGGG
GCAATTGTTGGATCCATGGGCTCAGGCCTCAACCAAGAGCAGCGCAAACGACTCACAATTGCAGTTGAACTAGCA
AGTAAACCAGAGCTTTTGCTATTCCTAGATGAACCCACGTCAGGCCTCGATTCTCTGGCCGCGTTCAACATTGTA
CGCTTCCTTCGCCGACTCGCAGATGCCGGTCAGGCCATTCTCTGCACAATACATCAACCTTCTGCTGTCTTATTC
GAGAACTTCGATGAGCTCTTGCTACTGAAAAGCGGTGGAATTGTTGTTTATAATGGGCCCCTTGGAAACGACTCC
AAGACGCTGATTGATTACTTTGAACAAAACGGCGGGAGGAATTGCTCACCACATGAAAATCCGGCAGAGTATATG
TTGGAAGTCATTGGAGCCGGAAATCCCGATTATAAGGGACAGGACTGGGGTAATGTATGGGCCAACTCGCCAGAA
TCCAAACAGCTTTCTGGGGACCTTGAAGGTATAATCGCCTCTCGTCGCAACGCTCAAAATGACCAGAAGGTTGAC
GACGATCGCGAATACGCGATGCCTCTCTATGTTCAAACAGTCGCAGTCACTAAGCGCGCATTCGTGGCTTACTGG
AGGATCCCAGACTACATCCTTGGTAAATTCATGCTCCACATCTTTACCGGCCTTTTCAACACCTTCACATTCTGG
CATTTGGGAAATAGCTTTATCGACATGCAATCACGACTTTTCTCTGTTTTCATGACCTTGACGATAGCCCCACCG
CTGATACAGCAACTCCAACCACGATATATTCATTTTCGAGGCCTTTATGAATCTCGAGAGGCTAACTCAAAGATC
TACTCTTGGGCTGCCTTTGTGACGAGCACAATCATCCCAGAACTGCCATACTCGGTTGTTGCCGGGTCCATTTAC
TTCAACTGCTGGTACTGGGGAACTTGGTTCCCGCGCGACTCGTTTACCTCCGGCTACGTTTGGATGTCGATGATG
CTTTTTGAACTATATTATATCGGCCTTGGTCAATTCATAGCTGCAATTGCACCAAATGTGCTATTTGCAAGTTTG
CTCGTGCCAACTTTCTTTACCTTTGTTGCTTCCTTCTGCGGCGTTGTCGTCCCTTATGTCGCAATACCGCATTTT
TGGCAAGCGTGGATGTACTGGCTTACGCCTTTCCACTATCTGCTTGAGGGATTTGTTGGAGCCATCACCCATAAT
GTCCCCGTGCGGTGTATTGAGCGCGAAGAATCCCGCTTTAGCACTCCACCTGGCATGAACTGCCAAGAATATGCT
GGGTCTTATGCCGAAAAATCCGGTGGATATGTCCGAGACATTGGGAATGGAATGTGCTCATTCTGTCAATACTCA
GTCGGTGATAATTTTGCTAGTAGCCTCAATGTTTTTTACTCGCACAAATGGAGAGATTATGGGATCATCTGGGGA
TTCATTATCTTCAACTTTGCTGTTGTTTTCATCTTCTCCTGGTTGTATTTGCACGGTATCAGCGACGTGAAACGC
TGGCTCAGTGCGCGTAAGACGAGAAAGAGCAAAGCTCGTCCTTGA
Gene >Pro_DTO377G3_2|g6709.t1
ATGGCAAACGACCATTCTATGGAAAGCGAGTCCGCATCATCTACAAACCCAGAACACATTCCTGAAAATTCCGTT
TCTTCCTCTGAGGGTTCATCTTCGCGAGCCAGTTCGTCTCCATCCGAAGCTTACACGCCAACCCGCACTGCCTCA
TCAGACACCCAGGCAGATTCCACGGCGCCAAAGAAAACTGACGATGGCCTCGCACGTACTAAATCTCGACACAAA
GCCTCCGGTCATGATCCTCAGGGAGAGGAATGGGCCCAGATAGAAAGACTGATCTCACGGATGTTCGGCCCTGAG
CGCAAAGCAAATTCCGAAGAAGAGAAAACACGTCATGTTGGAGTTCTATGGAAGAACCTCACTGTAAAAGGTGTC
GGCCTCGGAGCTGCTCTACAACCCACCAACGGGGATATTTTTCTCGGCTTACCACGGCTCATCAAGCAACTACTC
ACTCGGGGCAGAAAAGGTGCCGGGGCCAAAAAAGCAGCGATACGAACTATCTTAGATGATTTCAATGTGAGTATA
TTTCTCACCCCTAGAGATATGCCCGACTGATCTCGTATCAAGGGTTGTGTTCGTCCGGGGGAGATGCTTCTTGTT
CTGGGCCGCCCTGGCTCTGGCTGTTCCACTTTCTTGAAAATGCTTGGCAATCAACGAGCGGGCTACGAAAGCATT
GAAGGCGATGTGCGGTATGGCGGCACAGACTCTGAAAAAATGGCAAAGGAGTATAGGTCAGAAGGTGTGTCCCTG
TCTGTGTGACCATGATTCCGAACTAAAACTATCAGTCTTGTACAACCCTGAGGATGATCTCCATTATGCAACTTT
GACTGTGCGAGATACACTGCTTTTTGCCTTGAAAGCTCGAACCCCCGACAAAGCCTCAAGAATACCAGGAGAAAG
CCGAAAGGAATACCAGCAGACATTCTTGACCGCCATAGCTAAGTTGTTCTGGATTGAACATGCTCTGGGAACCAA
AGTTGGGAACGAACTCATTCGTGGAGTTTCTGGGGGTGAGAAGAAACGAACCTCAATTGCGGAAGCTATGGTTAC
AAAGGCTAGTACCCAGTGCTGGGACAACTCTACCAAGGGTTTGGACGCCAGTACAGCGCTAGAGTATGTTCAAAG
CTTGCGAAGTCTAACAAATACCGCCAACGTTTCAACGATAGTAGCTCTCTACCAGGCATCGGAGAATTTATTTGA
CCTTTTTGACAAGGTGATCTTAATCGAAGAGGGAAAATGCTCTTTCTTCGGCCCTACCCAGGACGCAAAGGCCTA
TTTCGAAGGACTGGGCTTTGAATGCCCCCCGCGTTGGACAACTCCCGACTTTTTGACTTCTGTCAATGACCCCTA
TGCGCGGCGTGTCAAAGATGGCTGGGACGACCGAATTCCTCGGAATGCAGCTGAATTTCAAGCTGCATATCGCAA
AAGTGATACTTACCAAAGCAACCTAGCGGATATGAAAAGCTTTGAGGGCGATATCGAAAGCCAAAGGCAGGAGAG
AGAGGCTGCAAGAAGTGAGGCCAAACGAAAAAACTTCACCATCTCATTCTACAAACAAGTTATGATTCTCACACA
TCGTCAATTTCTGGTAATGATTGGTGATAGAGATTCGTTGATTGGAAAGTGGAGTATGATAACCTTTCAAGCTCT
CATTATTGGTAGTCTATTTTACAACCTTCCCGATACAAGGTAAGCAATTGCCCCTCTAAATGCGAAGAGACTCCA
TATGGCTCACCGTTTCAAGTTCTGGCGTTTTTACTAGGGGTGGTGTGATGTTCCTTATACTGCTTTTCAATTCAT
TGCTTGCTATGGCAGAGCTGACAGCAGCATTTGGGAGCCGACCAATTTTGATGAAACACAAAAGCTTGTGAGGAC
TATAAAAAAAAAAGACAAAATGATGGGACTAATCTTTTCTAGCTCTTTCTACCGGCCAGCAGCATATGCGCTTGC
CCAGGTTGTGGTTGATGTGCCTCTCGTGTTCATACAAGTCGTTCTATTTGATATCATAGTATACTTGTGAGTCTC
ATTGGATTCTTTACGTGGATCAAACTGATGATGGATTTAGCATGGCAAATCTTGCTCGAACACCCTCACAGTTCT
TTATAAATCTGCTTTTCATTTTCATTCTCACAATGACTATGTACTCCTTCTTTCGTGCCCTGGGGGCTCTATGTG
CCTCATTGGATGTTGGTGAGTGGAACAAACCTCTCGGAATCAAGAAGTCTTCAATAACACTATATAGCCACCCGC
CTCACTGGTGTCGCCATACAGGCATTGGTTGTGTACACAGGTGAGCCCAGCAGAATGGAACCTAATATTCGAGTT
TAATGGCCAACAAAATTCAGGCTATCTCATCCCACCGTGGAAAATGCACCCATGGTTAAAGTGGCTCATTTGGAT
CAACCCTGTCCAATACGCATTCGAGGCATTGATGGCCAACGAGTTCCACAATCTCCAGATCAAATGTGAAACGCC
CTACATTGTGCCTGATGGGCCAAATGCTGTGCCTGGTCACCAGTCATGTGCAATACAAGGCAGTGATATAGACCA
GTTGATCGTTCATGGTCCCAAGTATATCCAAACGGCGTACACTTACTCCAGGGCTCACCTGTGGCGGAATTTCGG
CATCATTACAGGATGGCTTATCTTTTTCGTCTGCTTGACAATGTTGGGAATGGAATTACAGAGACCTAATAAGGG
CGGCAGCTCGGTCACGGTGTTCAAAAGAAGTGAAGCCCCCCAAGCAGTTCAAGATGTCATCAAGCAATCCGGCCC
CCGAAAAGATGAGGAATCCACAGAGGCGGATGGCGCAGCATCCAACGAAAACAACGGCGACACGAGTGTACCTCA
TGAAAAAGTCCGGGATATTGCTACAAACACGGCAATCTTTACATGGCAAGACGTTGACTACACCATTCCATACAA
GGGTGGACAGAGACAACTTTTGCAAAATGTTAAAGGGTATGTCAAGCCTGGTCGGCTGACTGCATTGATGGGTGC
TTCTGGCTCGGGGTAAGCACGTAACAAGGTTGACTTCATTCTTGATGCTAATGTCTGACTAGCAAAACCACCTTG
CTCAATGCGCTAGCACAGCGCATCAATTTTGGCGTGGTCACCGGCAACTTCTTAGTTGATGGGAGGTAGGATATC
TTTGAGTATTTCATTGAGAATGAATATTAATATTTTCAGGCCTCTCCCAAGGAGCTTTCAGAGAGCCACGGGATT
CGCCGAGCAGATGGACATTCACGAACCCACTGCTACTGTGCGGGAGTCTCTTCGGTTCTCCGCTCTGTTGCGGCA
GCCGAAAGAAGTCCCATTAAAAGAAAAGTATGATTATTGTGAGACAATCATTGACTTATTAGAAATGCGTTCCAT
CGCCGGGGCAATTGTTGGATCCATGGGCTCAGGCCTCAACCAAGAGCAGCGCAAACGACTCACAATTGCAGTTGA
ACTAGCAAGTAAACCAGAGCTTTTGCTATTCCTAGATGAACCCACGTCAGGCCTCGATTCTCTGGCCGCGTTCAA
CATTGTACGCTTCCTTCGCCGACTCGCAGATGCCGGTCAGGCCATTCTCTGCACAATACATCAACCTTCTGCTGT
CTTATTCGAGAACTTCGATGAGCTCTTGCTACTGAAAAGCGGTGGAATTGTTGTTTATAATGGGCCCCTTGGAAA
CGACTCCAAGACGCTGATTGATTACTTTGAACAAAACGGCGGGAGGAATTGCTCACCACATGAAAATCCGGCAGA
GGTGTGTATTATAAAGCTGGATGTATTGGTTCCCACTGATATTCGATCTAGTATATGTTGGAAGTCATTGGAGCC
GGAAATCCCGATTATAAGGGACAGGACTGGGGTAATGTATGGGCCAACTCGCCAGAATCCAAACAGCTTTCTGGG
GACCTTGAAGGTATAATCGCCTCTCGTCGCAACGCTCAAAATGACCAGAAGGTTGACGACGATCGCGAATACGCG
ATGCCTCTCTATGTTCAAACAGTCGCAGTCACTAAGCGCGCATTCGTGGCTTACTGGAGGATCCCAGACTACATC
CTTGTAAGTCACTAGGTCTCAAAAAACAAGCCCGAATGACTTGCCTAATTGCCAACTAGGGTAAATTCATGCTCC
ACATCTTTACCGGCCTTTTCAACACCTTCACATTCTGGCATTTGGGAAATAGCTTTATCGACATGCAATCACGAC
TTTTCTCTGTTTTCATGACCTTGACGATAGCCCCACCGCTGATACAGCAACTCCAACCACGATATATTCATTTTC
GAGGCCTTTATGAATCTCGAGAGGCTAACTCAAAGATCTACTCTTGGGCTGCCTTTGTGACGAGCACAATCATCC
CAGAACTGCCATACTCGGTTGTTGCCGGGTCCATTTACTTCAACTGCTGGTAAGTATCTATTGAGAAGGCATTTC
ATCTCTCCCCTCTGACAGAAATATAAAAGGTACTGGGGAACTTGGTTCCCGCGCGACTCGTTTACCTCCGGCTAC
GTTTGGATGTCGATGATGCTTTTTGAACTATATTATATCGGCCTTGGTCAATTCATAGCTGCAATTGCACCAAAT
GTGCTATTTGCAAGTTTGCTCGTGCCAACTTTCTTTACCTTTGTTGCTTCCTTCTGCGGCGTTGTCGTCCCTTAT
GTCGCAATACCGCATTTTTGGCAAGCGTGGATGTACTGGCTTACGCCTTTCCACTATCTGCTTGAGGGATTTGTT
GGAGCCATCACCCATAATGTCCCCGTGCGGTGTATTGAGCGCGAAGAATCCCGCTTTAGCACTCCACCTGGCATG
AACTGCCAAGAATATGCTGGGTCTTATGCCGAAAAATCCGGTGGATATGTCCGAGACATTGGGAATGGAATGTGC
TCATTCTGTCAATACTCAGTCGGTGATAATTTTGTAAGTTTCGCTTCTGAATTTCTTGACCAGCAGACTTGGAGC
ATAGCTAACTAGAACTTTGTTACATTTTTCAGGCTAGTAGCCTCAATGTTTTTTACTCGCACAAATGGAGAGATT
ATGTGAGTATCGTGATCTATACCCCTTTGACTAACCTTCAGAGTGCCAGATTAATCTAACATCCATTAGGGGATC
ATCTGGGGATTCATTATCTTCAACTTTGCTGTTGTTTTCATCTTCTCCTGGTTGTATTTGCACGGTATCAGCGAC
GTGAAACGCTGGCTCAGTGCGCGTAAGACGAGAAAGAGCAAAGCTCGTCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail